Dataset for protein Unclassified of organism Coregonus sp balchen

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6F9BT24_uncBCL2L10-02 Putative BCL2-like 10 protein OS=[Eukaryota] Coregonus sp. 'balchen' (length=243 residues).
MPFFVTFLVRRNRQYKEWREAGEGEIPLTTAIFLLPFVLGESSLIAGRTMSCGLWKETLAVAEDYLSVCSIVPASGSQKA
PPPPPPSESAAAMRRLARDMEAQHQARFHTLAHSFLCQCGPDPCTCLRRVMEELVGDGQMNWGRVVSLFTFTGVLVRELQ
GEDTDQGNGMGLGGKESCRALAETIADYLGEEKSDWMLQNKGWEGFCKFFHTAREVKQDLSMKTALFAAAGMGIAGLTFL
LVR
© 1998-2020Legal notice