Dataset for protein Bcl-xL of organism Chinchilla lanigera

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C2YUU6_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2L1 (length=233 residues).
MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEGPEGAESETETPSAINGNPSWHLADSRTVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVRRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C2YUU6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2L1 (length=233 residues).
MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEGPEGAESETETPSAINGNPSWHLADSRTVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVRRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C2YUU6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2L1 (length=233 residues).
MSQSNWELVVDFLSYKLSQKGYSWSQFSDVEENRTEGPEGAESETETPSAINGNPSWHLADSRTVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVRRIASWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2022Legal notice