Dataset for protein Unclassified of organism Chelonoidis abingdonii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C0G6P4_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Chelonoidis abingdonii (length=184 residues).
GPLRMDAAVLGAELDCCSGAGVSAYSIRSAFRLTSCSFFVLGLKDLQIQHFLPGMLQKLDVKNWEDLKSVFAVTTHIFSD
GITNSHRQTRMVKCSIRTVFMAFAGISGLAVSLANVIQRAMECLVPVLDYLEVLIGRKAVYGMSFISLAQSCDHRSLEMW
TSVFCTHCISSCFGLEVLKSILCK
© 1998-2022Legal notice