Dataset for protein BCL-2-like of organism Cebus capucinus imitator

[Download (right click)] [Alignment] [Repertoires]

16 sequence(s)

>gnl|bcl2dbpro|A0A2K5PP81_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL-2 (length=240 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPGPAAPRDPVARTSPPSPPAAPAA
AATGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCV
ESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A2K5PYQ3_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2A1 (length=156 residues).
MTDSEFGYIHNLTQDYLWYVLQIPQSGTGPSKTSRVLQKVAFSVQKPCLDNVNIVSIDNARTIFSQVMETEFEDGIINWG
RIVTIFAFEGILIKKLLQERIAPDVDTYKEISYFVAEYIMNNTGEWIRQNGGWGKWHSLMLMLVESVAQKKRKMAL
>gnl|bcl2dbpro|A0A2K5PYQ3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2A1 (length=168 residues).
MTDSEFGYIHNLTQDYLWYVLQIPQSGTGPSKTSRVLQKVAFSVQKPCLDNVNIVSIDNARTIFSQVMETEFEDGIINWG
RIVTIFAFEGILIKKLLQERIAPDVDTYKEISYFVAEYIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEM
LSLLKQYY
>gnl|bcl2dbpro|A0A2K5Q6R6_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L1 (length=146 residues).
MWKRTGLRPQKGLIRRWRPPVPSMLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIA
AWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5Q6R6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5Q6R6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2K5R5E2_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cebus capucinus imitator GN=MCL-1 (length=270 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGGGEAGAVIGGSVGASPPAALTPDARRVVRPP
PIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPGNGSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGVLPCRG
PRRWHQKCAAGFCRCCWSRSWFGISNKIAL
>gnl|bcl2dbpro|A0A2K5R5E2_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cebus capucinus imitator GN=MCL-1 (length=352 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGGGEAGAVIGGSVGASPPAALTPDARRVVRPP
PIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPGNGSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLIYFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGDCSDHATVLQPGNRARFLLKKRKRS
>gnl|bcl2dbpro|A0A2K5R5E2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cebus capucinus imitator GN=MCL-1 (length=350 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGGGEAGAVIGGSVGASPPAALTPDARRVVRPP
PIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPGNGSSTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLIYFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K5R5E2_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cebus capucinus imitator GN=MCL-1 (length=197 residues).
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLIYFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2K5RIU7_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L10 (length=229 residues).
MADPLRQRTERLVADYLEYCSREPGTPESPPATAEAAVLRATAAGVRKVYRSFFSAYLGYPGNRVELVARMAEALLSDSP
GPTWGNVVMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGNVSRDRQRLVGLLSSRLVGQHRAWLEAQGGWVSTRRGT
RGGMGTREGLTHVPRWLLLLLQDLLLTGIMEKIAGPGFPVMVVNSSIHLLLDTIIRSFKIFSPLLPAQL
>gnl|bcl2dbpro|A0A2K5RUN8_BCL2L2-05 BCL2-like 2 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L2 (length=270 residues).
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEDQEEEEEPGLVEGDPGDGAIED
PELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCG
SVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSS
RSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K5RUN8_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L2 (length=306 residues).
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAP
PGAPGPGPGSGAPGSQEEEEEPGLVEGDPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVI
MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K5RUN8_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L2 (length=346 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVDVKAFIYSSLTQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRF
YSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A2K5RUN8_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2K5RUN8_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L2 (length=204 residues).
HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLH
VTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTA
LYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2020Legal notice