Dataset for protein Unclassified of organism Capitella teleta

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|R7T3X7_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Capitella teleta (length=387 residues).
MDRDDKTRLRANLTTLRTIPVGEISDRLWVEGVLDDDDLDSFKVNKAPREISSDLFKTIIRKGQENHYAILCTVLKDEGY
EHVVQQLNATDLTQYNYNFDASPQKKMQALCEQLANMQQDIYAENEYLKSKLGTINRELKSVEEREARLRESKAEMDPNI
VAYINERITGRALPSDSVDAAGVGSLGSSFIPPYIQEWMNLRKPVMNANATEQIARQLGADIVSYKCMSDPPPAITTYAT
RMRAIVDEILVRYEESFVKFMDVLYLDEINGLQTLWNVADQVFADFKEGENPNWGHVCTLYAFGAYVAKHSFNGEADPQM
ANFVGDFLGYYVSKKLGATIVKTGGWNAFLQHFDRTASPDGRSMMLIFMSLAVWVSTIIFSLPGNEF
>gnl|bcl2dbpro|R7TIZ4_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Capitella teleta (length=220 residues).
MAPPSAADPLDRPQAMPQEACSDPQRQPQQQFVLTGDFLPSGFRVQSLQVAQDAIHYICQHESCAPPPNRTALIMRNLLD
DTLKHRLDMMRNLVMTLDIEERNQLELLHNIATSMFDDQLVNWGRIVTFHAFCGYLARYCEERQIPDCGDLIADILSSTV
INRLGLWIVANGGWNAFEQQFPPSCLWETKGVWKGIAIIALLIGAILAFYSSMRFMNSSS
© 1998-2022Legal notice