Dataset for protein Unclassified of organism Canis lupus familiaris

[Download (right click)]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C0TKY6_uncBCL2L10-04 Putative BCL2-like 10 protein OS=[Eukaryota] Canis lupus familiaris (length=518 residues).
MGTTLPASRGGVRSSATAGIALGTAPGARGRCPAGRGGAGGGAAGIALGTAPGGGAGAAGARGGARGGAAGIALGTAPGA
RGRCPGGGAGPRGARRAGGPTAGGSAAAAPLAPPASAPEGGAAAGRRQPEPRRGPLPPARRPGLRRPRARSPASPLPSPP
RPGAKMATDGLHENQTLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDK
RRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNY
LSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAF
ETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKG
SRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA
>gnl|bcl2dbpro|A0A8C0TKY6_uncBCL2L10-02 Putative BCL2-like 10 protein OS=[Eukaryota] Canis lupus familiaris (length=395 residues).
MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATDGLHENQTLASLKSEAESLKGKLEEERAKLHDVEL
HQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGC
AIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADV
LCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYS
KESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA
>gnl|bcl2dbpro|A0A8C0TKY6_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Canis lupus familiaris (length=555 residues).
MGTTLPASRGGVRSSATAGIALGTAPGARGRCPAGRGGAGGGAAGIALGTAPGGGAGAAGARGGARGGAAGIALGTAPGA
RGRCPGGGAGPRGARRAGGPTAGGSAAAAPLAPPASAPEGGAAAGRRQPEPRRGPLPPARRPGLRRPRARSPASPLPSPP
RPGAKMATDGLHENQTLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDK
RRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNY
LSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAF
ETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKG
SRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRDGFCLFFTPMLPSSWKRLLVKVLLSCFATMILIYFWKRLS
>gnl|bcl2dbpro|A0A8C0TKY6_uncBCL2L10-05 Putative BCL2-like 10 protein OS=[Eukaryota] Canis lupus familiaris (length=283 residues).
MATDGLHENQTLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVS
SSQDGKVIVWDSFTTNKILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQ
CVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVW
DVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA
>gnl|bcl2dbpro|A0A8C0TKY6_uncBCL2L10-03 Putative BCL2-like 10 protein OS=[Eukaryota] Canis lupus familiaris (length=382 residues).
MGITVSIQGDCCDLLTQSAWNSAWHQDFYMATDGLHENQTLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQF
VMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSV
YPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNT
FVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDF
SLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA
© 1998-2022Legal notice