Dataset for protein BCL-2-like of organism Cairina moschata domestica

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C3BNR4_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Cairina moschata domestica GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMDEKFA
DGNTNWGRITTIFTFGGLLTKKLQEHGVQLTGEKKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
DLFVAVFSLFREYY
>gnl|bcl2dbpro|A0A8C3CGW6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cairina moschata domestica GN=BCL2L1 (length=227 residues).
MSSGNRELVIDFVAYKLSQKGYSWSQLEEEDENRTEVAAEADAVLNGSPSWHPPAGQVVNGAAVHRSGLEVRELVQSAGV
RQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRI
VAWMTTYLSDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C3CIW8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cairina moschata domestica GN=BCL-2 (length=277 residues).
PLGDLKHQSSRSLTFLKTWRCLGRVVAGVFCRGNLTEEHIYSPKRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPAPTA
LAPAAAAVAAAGTPSRHRPAGLLSPHPEPPGSAAASEAPPGEGLRPAPPVVHLALRQAGDEFSRRYQRDFAQMSGQLHLT
PFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELY
GNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C3GNC2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cairina moschata domestica GN=MCL-1 (length=422 residues).
MFALPRNALIGFNLYCGGGTGPGGGGGGGGGGGGPASTGGTPAPPPPSPHAAAPPPPFPAARGAPCSLLIGSAAAPRSLI
GSAAPPLWSPEEELDGCEPEAELGGPGGGGGGSLPGTPPELPTDELRQDSLELILRYLREAAGETEPGLKKFFPGLLGRP
GGVAGGDGVMEKALETLRRVGDGVLEKHELAFQGMLRKLEIKKEEDLQAVGEVAAHLFSDGVTNWGRVVTLISFGAFVAR
HLKSVKQEKSIGSLARIITDALVSSKREWLVSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIRKACAGR
IARGPMRIIALGAESGRSSVNRLGLRAQGDCFGFTPGVLASPRPKPRGLGVAGARYSELLVRAAPLSELRVRARRRLGKE
RSHPGGWQQVAGRRRSGAGAAR
© 1998-2022Legal notice