Dataset for protein Bcl2l10 of organism Bos taurus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A4W2C0F3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos indicus GN=BCL2L10 (length=191 residues).
SADSLHSMVDPFRERTARLLMDYLEFCAREPGTPVPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQ
RLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQKRDDDGVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLFFSQ
SFQPSWERQLVWFFLAYWTAIIIIYFWIKLL
>gnl|bcl2dbpro|A0A4W2EB77_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos indicus GN=BCL2L10 (length=184 residues).
MVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQRLLDEDP
GPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHRAWLMTNGGWDGFCLFFPLIPPSWE
RQLVWFFLSYWTAIIIIYFWIKLS
>gnl|bcl2dbpro|A0A4W2FG99_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos indicus GN=BCL2L10 (length=191 residues).
SADSLHSMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQ
RLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQKRDDDGVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLFFSQ
SFQPSWERQLVWFFLAYWTAIIIIYFWIKLL
>gnl|bcl2dbpro|E1B9B3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos taurus GN=BCL2L10 (length=248 residues).
MTEGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQR
LLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHRAWLMTNGGWVSAKDAGLV
GSLGRAHAAGWILSLLQPLIPAILGKTAGLVFPLILDSNNHNLLLDKIIVSSKILISTCLTLSNQAKLKCERPNQSKPPS
ETFLSAFM
>gnl|bcl2dbpro|F1MV39_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos taurus GN=BCL2L10 (length=187 residues).
VADGQESLVERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQRLLD
EDPGPSWGRVASLVTFAGSLLERPPQTTRRQKRDDDGVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLFFSQSFQP
SWERQLVWFFLAYWTAIIIIYFWIKLL
© 1998-2022Legal notice