Dataset for protein Unclassified of organism Bos mutus grunniens

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A8B9X4S5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos mutus grunniens (length=189 residues).
LVTPWTASNCELVVDFLSYKLFQKGYSNKLGRWEVIPMATVKQALREAGNEFELRYHQTFSDLMSQLHITPGTAYQSFEQ
VVYELFWDGVNWGDKEMQVLVSQITTWMATYLNDHLEPWIQDNGSWDTFVELFLWKQYSNPEPQGPRRSKRFIGWLILGI
LGLIAICTTAAIADIALQTSVQTHNFIQN
>gnl|bcl2dbpro|A0A8B9X5I6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos mutus grunniens (length=174 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDMEENRTETPEGTESDMEIPSAINGNPSWHVADSPAVNGAIGHSRSLDARKM
IPMTTVKQALREASNEFELRYQQTFSDLTSQLHITPGTAYQSFEQENGDWDTFVELYENNTTTESQKGQESFNCWSLMDV
SVAGVVPLGLLFNS
>gnl|bcl2dbpro|A0A8B9XXC8_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos mutus grunniens (length=152 residues).
MKGVCGPPRLAGLAEPCLGFGSSKRTTKQRPDPVSEQVFWTMDHGAHPYYKMSQSNRELVVDFLSYKLSQKGYSWSQFSD
VEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREVIPMAAVKQALRDGLSKLRPQI
© 1998-2022Legal notice