Dataset for protein Bcl-w of organism Bos mutus grunniens

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9WT05_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Bos mutus grunniens GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2022Legal notice