Dataset for protein Bcl2l10 of organism Bos indicus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A4W2C0F3_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos indicus GN=BCL2L10 (length=191 residues).
SADSLHSMVDPFRERTARLLMDYLEFCAREPGTPVPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQ
RLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQKRDDDGVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLFFSQ
SFQPSWERQLVWFFLAYWTAIIIIYFWIKLL
>gnl|bcl2dbpro|A0A4W2FG99_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Bos indicus GN=BCL2L10 (length=191 residues).
SADSLHSMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAARIQEANRNVLPLYRRCRRHRVELVARMAQ
RLLDEDPGPSWGRVASLVTFAGSLLERPPQTTRRQKRDDDGVSRDCRLLVALLCAQFCERHRAWLMANGGWDGFCLFFSQ
SFQPSWERQLVWFFLAYWTAIIIIYFWIKLL
© 1998-2023Legal notice