Dataset for protein Mcl-1 of organism Athene cunicularia

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A663M6G8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Athene cunicularia GN=MCL-1 (length=157 residues).
RGRAGARLQTDFCAVVLMRWGFKALVRKGSVMSSLAGMLRKLEIQKEEDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAF
VAKHLKSINQEKCISSLAGIITDALISSKREWLMSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASLAYMIR
© 1998-2020Legal notice