Dataset for protein Mcl-1 of organism Anser brachyrhynchus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9BNC2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anser brachyrhynchus GN=MCL-1 (length=331 residues).
MKIRGGKKKRGKIGEKCKAPVRGGDGGGTAPPPRLPPARGEEATVTTEGEKQQEQLRDATAAWSGVTYPCGGAQGLFFWG
GGSDGVALRQEGLRQLSCVPEGAGENPGGLQVGRATFARCSSPSFVGGGSEAPPYPPIGCWGPLGTRGPIPLCRAAPAPQ
HFSAEQPGGLPPPLSPPAGGDGGKSWNLFTYLFLPGVLLRAPVSEPASLAGMLRKLEIKKEEDLQSVGEVAAHVFSDGVT
NWGRVVTLISFGAFVAKHLKSIKQEKCIGSLARIITDALVSSKREWLLSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVA
GLGASLAYMIR
© 1998-2022Legal notice