Dataset for protein Bfl1 of organism Anser brachyrhynchus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9CVY0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Anser brachyrhynchus GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
DIFVALFSLFREYY
© 1998-2022Legal notice