Dataset for protein Unclassified of organism Anolis carolinensis

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A803STF8_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Anolis carolinensis (length=159 residues).
MDWTHPDRLPEIEKQTFRIIQSYLNLAAGKAPKTSLDTEICISLQKMNELDARIFPIISPLQLDTPTQSCEILQHVMQQT
FSDGKINWGRIFSIILFGCILVRKMPYTEVHVDNVAECIAAFLLDHESKWLCRHGGLVKSYFSFFLGTWGEIHECSNGW
>gnl|bcl2dbpro|A0A803TIE0_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Anolis carolinensis (length=152 residues).
LNTITCGYFSYLQRDVLWGIQLPRVFEVDRLVVFGVGMLVSLSGNSCEILQHVMQQTFSDGKINWGRIFSIILFGCILVR
KMPYTEVHVDNVAECIGCCMSFGLNGHVPKVFSPNNNNNNNNNNNNNTLFIPRHHLPNGDIYGRHPQRLNYI
>gnl|bcl2dbpro|A0A803TYD1_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Anolis carolinensis (length=170 residues).
MTKCLFCGKQTIISEKTHTHWKLKNKPFRIIQSYLNLAAGKAPKTSLDTEICISLQKMNELDARIFPIISPLQLDTPTQS
CEILQHVMQQTFSDGKINWGRIFSIILFGCILVRKMPYTEVHVDNVAECIAAFLLDHESKWLCRHGGLVKSYFSFFLGTW
GEIHECSNGW
© 1998-2022Legal notice