Dataset for protein Bcl-xL of organism Anas platyrhynchos platyrhynchos

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A493TIA6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=BCL2L1 (length=238 residues).
MSSGNRELVIDFVSYKLSQKGYSWSQLEEEDENRTELASEAAAVLNGSPSWHPPAGQVVNGAAVHRSSLEVHELVQSAAV
RQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRI
VAWMTTYLSDHLDPWIQENGGWVRGCSFCTPLGDLGWIWPLSALQITPPPRPPPPRTPPRPLPLPPSLPPSLPPGLGF
© 1998-2020Legal notice