Dataset for protein Bax of organism Haliotis discus hannai

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8F4XB69_BAX-01 BCL2-associated X protein OS=[Eukaryota] Haliotis discus hannai GN=BAX (length=204 residues).
MSRERYHPLARSKQPVDRHLSRDDITNQGRYLLNTFIHERMRQDGIQQAPALDELQEPGTPCGPPMQHTTEIARALRCIG
DQLDGDVRLQNLINQVQPDAQRSTFLNVAQSIFSDGVFNWGRVVALFYFAYKMALKALDKIPLVRAIINLVIDFLRDKVA
QWIIDRGGWEAIVEYFGTPSKQVLLVLGAGVVISGAIYLWKGWH
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice