Dataset for protein BAX-like of organism Gadus morhua

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A8C4Z5R5_BAX-02 BCL2-associated X protein OS=[Eukaryota] Gadus morhua GN=BAX (length=185 residues).
MERQGTPRDDIIEVGKILLTDFIYQRVLRNGDGPAVSRAELGGKELTNQNHKNLAQCLQQIGDDLDGNTQLQNMINSSAL
VPSKDVFLSVAREIFSDGVFNWGRVVALFYFACRMVIKALMTRVPDIIRTIISWTMDYLSENVMNWIREQGGWEGIRSYF
GTPSWQTFGVFVAGVLAAAIVMRKL
>gnl|bcl2dbpro|A0A8C4Z5R5_BAX-04 BCL2-associated X protein OS=[Eukaryota] Gadus morhua GN=BAX (length=295 residues).
MGTPRDDIIEVGKILLTDFIYQRVLRNGDGPAVSRAELGGKELTNQNHKNLAQCLQQIGDDLDGNTQLQNMINSSALVPS
KDVFLSVAREIFSDGVFNWGRVVALFYFACRMVIKALMTRVPDIIRTIISWTMDYLSENVMNWIREQGGWVSCLCSNSNP
KISFINHRDTKSLITIIGRNSILFWNPFMANLWGLRGRSPGRCNRHAQAVSSCRGEMQRERRRLKHLQWVGSVVRDEKSE
KAANGNRKHQQISVLHKIRSMFFFSLASICVATVRSSIAIGCSCLPCISEFSGNS
>gnl|bcl2dbpro|A0A8C4Z5R5_BAX-03 BCL2-associated X protein OS=[Eukaryota] Gadus morhua GN=BAX (length=304 residues).
MASPNGGGDSGTPRDDIIEVGKILLTDFIYQRVLRNGDGPAVSRAELGGKELTNQNHKNLAQCLQQIGDDLDGNTQLQNM
INSSALVPSKDVFLSVAREIFSDGVFNWGRVVALFYFACRMVIKALMTRVPDIIRTIISWTMDYLSENVMNWIREQGGWV
SCLCSNSNPKISFINHRDTKSLITIIGRNSILFWNPFMANLWGLRGRSPGRCNRHAQAVSSCRGEMQRERRRLKHLQWVG
SVVRDEKSEKAANGNRKHQQISVLHKIRSMFFFSLASICVATVRSSIAIGCSCLPCISEFSGNS
>gnl|bcl2dbpro|A0A8C4Z5R5_BAX-01 BCL2-associated X protein OS=[Eukaryota] Gadus morhua GN=BAX (length=298 residues).
MERQGTPRDDIIEVGKILLTDFIYQRVLRNGDGPAVSRAELGGKELTNQNHKNLAQCLQQIGDDLDGNTQLQNMINSSAL
VPSKDVFLSVAREIFSDGVFNWGRVVALFYFACRMVIKALMTRVPDIIRTIISWTMDYLSENVMNWIREQGGWVSCLCSN
SNPKISFINHRDTKSLITIIGRNSILFWNPFMANLWGLRGRSPGRCNRHAQAVSSCRGEMQRERRRLKHLQWVGSVVRDE
KSEKAANGNRKHQQISVLHKIRSMFFFSLASICVATVRSSIAIGCSCLPCISEFSGNS
>gnl|bcl2dbpro|A0A8C4ZA97_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Gadus morhua GN=BOK (length=223 residues).
MEMLRRSSVFAAEVMDVFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGWTKPDHGLSASGGSALGDTSSVILWLGDELE
YLRPNIYRNVAKQLNITVASESIVSDAFLAVAAEIFSTGPLAKHTITCVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTI
VDCMGEFVRKSLIPWLKRRGGWVDVTKCVINTDPSFRAHWLVSAASTCGQYLKAVVFYLLREK
>gnl|bcl2dbpro|A0A8C4ZA97_BOK-02 BCL2-related ovarian killer protein OS=[Eukaryota] Gadus morhua GN=BOK (length=214 residues).
MEMLRRSSVFAAEVMDVFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGWTKPDHGLSASGGSALGDTSSVILWLGDELE
YLRPNIYRNVAKQLNITVASESIVSDAFLAVAAEIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVR
KSLIPWLKRRGGWVDVTKCVINTDPSFRAHWLVSAASTCGQYLKAVVFYLLREK
>gnl|bcl2dbpro|A0A8C4ZB81_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Gadus morhua GN=BOK (length=213 residues).
MEVLRKSSEFAAEVLDVFDRSVSDKELVFQAKALYRDYVLCRLNQHGFGWARSELHFPSTSAALAEVSLVLLYLGDELEC
MHPSLYRNVARQLNISVAMENMVSDAFIAVATEIFSTGITWGKVVSMFAVAAGLAVDCVRQGRPATVHVLVDSLGQLVRR
YLVPWLKRKGGWTEISKCVIKKDVISEHHWLSSTVESLKYFLTTVYVYVMKEQ
>gnl|bcl2dbpro|A0A8C4ZIU9_BAX-03 BCL2-associated X protein OS=[Eukaryota] Gadus morhua GN=BAX (length=201 residues).
MADADGRDRAEEQGAAGGEDVIDDPIMEQGALVLRGYVMHRIGDIDPAMQVSSEDLGGARNEQQDPQIKAVVEQLLQIAD
DLNQNAELQSLISQVQGNCVQDVFMKVAKSIFNDGITWGRVVALFHLAYKLIYKALTMNHMENIRIIISWVLQFIREQLH
TWIAQQGGWEGVVRGISRWRTVTALASVVLVVAFVYYRKSR
>gnl|bcl2dbpro|A0A8C4ZIU9_BAX-04 BCL2-associated X protein OS=[Eukaryota] Gadus morhua GN=BAX (length=204 residues).
MADADGRDRAEEQGAAGGEDVIDDPIMEQGALILRGYVMHCISAYDPAMQVSSEDLGGAPNEQLDPQMKELVEMMREKSD
VLDQNAELENLISQVQGNCVQGVFMKVAKSIFNDGITWGRVASLFYLAYKFIYKALTMNHMENIRIIISWVLQFIREQLH
PWIAQQGGWGRKEGVVRGISRWRTVTALASVVLVVAFVYYRKSR
>gnl|bcl2dbpro|A0A8C4ZIU9_BAX-01 BCL2-associated X protein OS=[Eukaryota] Gadus morhua GN=BAX (length=201 residues).
MADADGRDRAEEQGAAGGEDVIDDPIMEQGALILRGYVMHCISAYDPAMQVSSEDLGGAPNEQLDPQMKELVEMMREKSD
VLDQNAELENLISQVQGNCVQGVFMKVAKSIFNDGITWGRVASLFYLAYKFIYKALTMNHMENIRIIISWVLQFIREQLH
TWIAQQGGWEGVVRGISRWRTVTALASVVLVVAFVYYRKSR
>gnl|bcl2dbpro|A0A8C4ZIU9_BAX-02 BCL2-associated X protein OS=[Eukaryota] Gadus morhua GN=BAX (length=201 residues).
MADADGRDRAEEQGAAGGEDVIDDPIMEQGALVLRGYVMHRIGDIDPAMQVSSEDLGGARNEQQDPQIKAVVEQLLQIAD
DLNQNAELQSLISQVQGNCVQDVFMKVAKSIFNDGITWGRVVALFHLAYKLIYKALTMNHMENIRIIISWVLQFIREQLH
TWIAQQGGWEGVVRGISRWRTVTALASVVLVVAFVYYRKSR
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice