Dataset for protein Bak1 of organism Erpetoichthys calabaricus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4RFL5_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Erpetoichthys calabaricus GN=BAK1 (length=214 residues).
MATGGEEDPFSSNNREDNNSQNQPDSEEQVIEETESVFCSYVFHRYQQESQTEEGEVPKDPEILDLQPRLYSTPYRVGHQ
LAIIGDDINRRYDHEFRRMLSQLALTPQNAYIYFCKIATSLFESEINWGRVIALLGFGYRMALHVFQQGITGFLSQIGRF
IADFLLRNRIAQWIAQQGGWVAVLDLDNVYLKYMFALFAVVFLGHIILKRFFRS
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice