Dataset for protein Bax of organism Castor canadensis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A250YBQ3_BAX-01 BCL2-associated X protein OS=[Eukaryota] Castor canadensis GN=BAX (length=192 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELTLEQMHQDASTKKLSECLKRIGDELDSNMELQRMI
ADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLEFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
>gnl|bcl2dbpro|A0A250YBQ3_BAX-02 BCL2-associated X protein OS=[Eukaryota] Castor canadensis GN=BAX (length=173 residues).
MKTGALLLQGFIQDRAGRMGGETPELTLEQMHQDASTKKLSECLKRIGDELDSNMELQRMIADVDTDSPREVFFRVAADM
FADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLEFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAG
VLTASLTIWKKMG
© 1998-2020Legal notice