Dataset for protein Bak1 of organism Callorhinchus milii

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A4W3JVN7_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Callorhinchus milii GN=BAK1 (length=217 residues).
MASGGDGDPFRSNLPRNRKNLHRRPSRPVTEEGVVQETEEVFRSYVFFRYQTEREEGGNVPEDPEIAEMHQSPESTTALV
GRQLAVIGDDINRRYDLEFHNLLSTLPLNAENAYDYFRKIALGLFESGINWGRVIALLGFGYRMALYVFQRGIKGFISQI
AKFVAEFVLRNRIARWIAAQGGWVAALDLDNVYMKWMAGILAVVLMGVFVIHKFYRP
>gnl|bcl2dbpro|A0A4W3KJU8_BAK1-03 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Callorhinchus milii GN=BAK1 (length=275 residues).
MSPESSSLTFRSTKKTLPSVVLVAQQYNIIKVQSVVRGKAPSSNCVRNSQGPLNDFAFICLLFLSELMTLQSVYFPPTEQ
NMVKEAEDVFRNYVYQRYQTEVEERVQDGFVTPAMQEMTVQQQSGLSSTMQIGRQLAVIGDEINQRYKWEFRSVLAWNAL
TLENIFESFCSVAERLFDAGINWGQIIALLSFGYRMSIYIHQRGILGFFGRIAKYVAKFIWKNQIAQWIMAQGGWVSMQC
SVAAYYYTIMHIIIQLHNKLFIAYLINDQIKMDPV
>gnl|bcl2dbpro|A0A4W3KJU8_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Callorhinchus milii GN=BAK1 (length=215 residues).
MATWSSCDPCRSCSPHEEKSSEADAEQNMVKEAEDVFRNYVYQRYQTEVEERVQDGFVTPAMQEMTVQQQSGLSSTMQIG
RQLAVIGDEINQRYKWEFRSVLAWNALTLENIFESFCSVAERLFDAGINWGQIIALLSFGYRMSIYIHQRGILGFFGRIA
KYVAKFIWKNQIAQWIMAQGGWTAAFSVENASLKYLCGIVAVVVLGVAIAHGVYK
© 1998-2020Legal notice