Dataset for protein BAX-like of organism Buteo japonicus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8B9Z9A2_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Buteo japonicus GN=BOK (length=213 residues).
MEVLRRSSVFAAEVMEVFDRSPTDKELVSQAKALCRDYINSRLIRAGVSWSKPECNAPVPGGKLAEVSAILLRLGDELEY
IRPNVYRNIARQLNISLHSETVVTDAFLAVAAQIFTAGITWGKVVSLYAVAAGLAVDCVRHAQPAMVHTIVDCLGEFVRK
TLVTWLKRRGGWADITKCVVNTDPSLRSHWLVAAVCSFGHFLKAIFFVLLPER
>gnl|bcl2dbpro|A0A8C0AQK9_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Buteo japonicus GN=BAK1 (length=212 residues).
PLPGCSLPLAVQRARGFHGYFLAKHYQVVEETEEVFRSYAFYRYQQEREERGEEVPMDPEIVEIQQELGSTGSRVGRRLA
IIGDDINKRYDAEFRCMLKSLQPTKENVYEHFTRIASSLFESGINWGRVIALLGFGYRMAIHVYQHGTRGFLYWITRYVS
EFMLRNRIAQWIAQQGGWVAALELDNVYMKYMLVVVALVMVGHLVVRRFFRP
>gnl|bcl2dbpro|A0A8C0HK19_BAX-01 BCL2-associated X protein OS=[Eukaryota] Buteo japonicus GN=BAX (length=127 residues).
MIEQVGCHAPKELFFRVAAEMFADGTFNWGRVVALFYFACKLVLKALCTKVPELVRTILGWTMEYMRDHVLAWIQAQGGW
VSRDGREPPPQTAALPLQCCAAPGASCWGCPLPSALAATWWPPSMTT
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice