Dataset for protein Bax of organism Aotus nancymaae

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5D846_BAX-04 BCL2-associated X protein OS=[Eukaryota] Aotus nancymaae GN=BAX (length=177 residues).
MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIGGETPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVT
LLPLPIFRSSDVVSNAF
>gnl|bcl2dbpro|A0A2K5D846_BAX-01 BCL2-associated X protein OS=[Eukaryota] Aotus nancymaae GN=BAX (length=193 residues).
MDGSGEQPRGEGPTSSEQIMKTGALLLQGFIQDRAGRIGGETPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCAKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFFGTPTWQTVTIFVAGVLTASLTIWKNMG
© 1998-2020Legal notice