Dataset for protein BAX-like of organism Acanthaster planci

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A8B7XNT5_BAX-03 BCL2-associated X protein OS=[Eukaryota] Acanthaster planci GN=BAX (length=217 residues).
MAEGGGGDGDSPMDGHDEVDDGARRFRTQHSYHEVSEQATVLLRHFIVDRFERDSVPGAPRLEDLGQATPEQEEVWRRVG
TTLREIGDILDQDRELQRWINSLPTDSPIEKIIAVAQVIFGDGEIHWGRIIGLFYFAYRISVRAMESLLLQNFPGWVNQL
IKEIVQFLVRRFADWIINRGGWTAIKEYFGSSNRVFRTIMILSLLTLGYGIYKLNKE
>gnl|bcl2dbpro|A0A8B7XNT5_BAX-05 BCL2-associated X protein OS=[Eukaryota] Acanthaster planci GN=BAX (length=217 residues).
MAEGGGGDGDSPMDGHDEVDDGARRFRTQHSYHEVSEQATVLLRHFIVDRFERDSVPGAPRLEDLGQATPEQEEVWRRVG
TTLREIGDILDQDRELQRWINSLPTDSPIEKIIAVAQVIFGDGEIHWGRIIGLFYFAYRISVRAMESLLLQNFPGWVNQL
IKEIVQFLVRRFADWIINRGGWTAIKEYFGSSNRVFRTIMILSLLTLGYGIYKLNKE
>gnl|bcl2dbpro|A0A8B7XNT5_BAX-04 BCL2-associated X protein OS=[Eukaryota] Acanthaster planci GN=BAX (length=217 residues).
MAEGGGGDGDSPMDGHDEVDDGARRFRTQHSYHEVSEQATVLLRHFIVDRFERDSVPGAPRLEDLGQATPEQEEVWRRVG
TTLREIGDILDQDRELQRWINSLPTDSPIEKIIAVAQVIFGDGEIHWGRIIGLFYFAYRISVRAMESLLLQNFPGWVNQL
IKEIVQFLVRRFADWIINRGGWTAIKEYFGSSNRVFRTIMILSLLTLGYGIYKLNKE
>gnl|bcl2dbpro|A0A8B7ZK32_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Acanthaster planci GN=BAK1 (length=273 residues).
MIVCVFQIRENDNGEETRRLQQPQQPQEVPFHAASHMRLNDVPTASLAQRRLSRASAEPAMATYQSTSTETTERLSPDTE
DNVVEQTESIVRNYMFIRYQTDLQSEESELAIATPRIPEFQCFTANPLSPTSQIGRRLAQIGDEINSQYECEFRDMISQL
RITPATAYEAFARVARRLFTQGINWGRIAALLSFGYQVAISVKAGIGEFIGKIIGSIVQFICTERIAQWISQQGGWRAAL
SYQLESSEGFRLFLAVSVAVATTAGIMYWIGRR
>gnl|bcl2dbpro|A0A8B7ZK32_BAK1-02 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Acanthaster planci GN=BAK1 (length=296 residues).
MTMGQFSPVGTQCMVCTCTSPVSLHRTLSLRQENDNGEETRRLQQPQQPQEVPFHAASHMRLNDVPTASLAQRRLSRASA
EPAMATYQSTSTETTERLSPDTEDNVVEQTESIVRNYMFIRYQTDLQSEESELAIATPRIPEFQCFTANPLSPTSQIGRR
LAQIGDEINSQYECEFRDMISQLRITPATAYEAFARVARRLFTQGINWGRIAALLSFGYQVAISVKAGIGEFIGKIIGSI
VQFICTERIAQWISQQGGWRAALSYQLESSEGFRLFLAVSVAVATTAGIMYWIGRR
>gnl|bcl2dbpro|A0A8B7ZK32_BAK1-03 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Acanthaster planci GN=BAK1 (length=286 residues).
MLAFSCFARNLLSNWNATVGDRENDNGEETRRLQQPQQPQEVPFHAASHMRLNDVPTASLAQRRLSRASAEPAMATYQST
STETTERLSPDTEDNVVEQTESIVRNYMFIRYQTDLQSEESELAIATPRIPEFQCFTANPLSPTSQIGRRLAQIGDEINS
QYECEFRDMISQLRITPATAYEAFARVARRLFTQGINWGRIAALLSFGYQVAISVKAGIGEFIGKIIGSIVQFICTERIA
QWISQQGGWRAALSYQLESSEGFRLFLAVSVAVATTAGIMYWIGRR
>gnl|bcl2dbpro|A0A8B7ZK32_BAK1-04 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Acanthaster planci GN=BAK1 (length=304 residues).
MVLCRIVSRGEIKVVEGRRGCLAWEILWSSMEGCAEPESNENDNGEETRRLQQPQQPQEVPFHAASHMRLNDVPTASLAQ
RRLSRASAEPAMATYQSTSTETTERLSPDTEDNVVEQTESIVRNYMFIRYQTDLQSEESELAIATPRIPEFQCFTANPLS
PTSQIGRRLAQIGDEINSQYECEFRDMISQLRITPATAYEAFARVARRLFTQGINWGRIAALLSFGYQVAISVKAGIGEF
IGKIIGSIVQFICTERIAQWISQQGGWRAALSYQLESSEGFRLFLAVSVAVATTAGIMYWIGRR
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice