Dataset for protein Bim of organism Salmo salar

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1S3SAH9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Salmo salar GN=BCL2L11 (length=214 residues).
MSDSSRQQNQSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFSERDQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSG
YFSFDSDSIPSSPVLKDNKSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPPPTAGDMWPETLIGQELQ
RIGDEFNDLVMHRLVDGNGQVAQENLQQMHQEPAFLLWMGLLIGRLLQIILQRR
© 1998-2020Legal notice