Dataset for protein Bim of organism Phasianus colchicus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A669QMB4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Phasianus colchicus GN=BCL2L11 (length=175 residues).
MAKQPPEAKAPRDRRAGRLPPGEGPGPAVPLRPGAPAALPGAARPASPGSPGPFAIRSPLFFFVRRSPLLPRSSSGYFSF
EAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPEIWIAQELRRIGDEFNASYCPRRVIFLFLLSIS
LPTKAPPVSGLAVNW
© 1998-2020Legal notice