Dataset for protein Unclassified of organism Nothobranchius furzeri

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6KX77_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Nothobranchius furzeri (length=155 residues).
CDGSKPLNAAAPSAGGDPSSTGCVPDSERNTHSRERSFAHPSSAGEEPESPSWSPNPASLDVFRRRSIFRANRRSSSGYF
SFESISLPNSPLFPSAETTDQATQTPSLTGQVMNHALHQMAVGHGEGPGTHALHGEHRQTGLKTSRLVHVPKTSS
© 1998-2022Legal notice