Dataset for protein classical BH3-containing proteins of organism Equus asinus asinus

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A8C4KX59_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Equus asinus asinus GN=BIK (length=181 residues).
MSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTESSPDSDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVYSLAFT
YNQTGLRGVFRSFMDGLTNLRENIRFWSFLTHRDRVSLRFHDLDSPSCMCSPLEPWSSCPVGHSLAGCCSPHQSLLSSFA
CFTHSSSCLFPGPLGLRWLAY
>gnl|bcl2dbpro|A0A8C4L4F7_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Equus asinus asinus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPAAPPAVTAALGGPRWPGG
PRSRPRAPRPDGPQPSLLPAEQHLESPVPSAPGALEGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGRAAPEMEPN
>gnl|bcl2dbpro|A0A8C4L824_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Equus asinus asinus GN=BCL2L11 (length=149 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADMRPEVWIAQELRRIGDEFNASYPRRVMLFSLILFLPIPSPQQHIKKKTVTSNNSVLMLEMRGVTCV
>gnl|bcl2dbpro|A0A8C4L824_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Equus asinus asinus GN=BCL2L11 (length=149 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADMRPEVWIAQELRRIGDEFNASYPRRVMLFSLILFLPIPSPQQHIKKKTVTSNNSVLMLEMRGVTCV
>gnl|bcl2dbpro|A0A8C4L824_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Equus asinus asinus GN=BCL2L11 (length=205 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQGNPGGEGDRCPQGSPLGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEVWIAQELRRIGDEFNAS
YPRRVMLFSLILFLPIPSPQQHIKKKTVTSNNSVLMLEMRGVTCV
>gnl|bcl2dbpro|A0A8C4LTR5_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Equus asinus asinus GN=HRK (length=91 residues).
MCPCPLHRGRGPRAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPEPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A8C4MCB2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Equus asinus asinus GN=BMF (length=184 residues).
MESPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQTLLFLHNLALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A8C4MCB2_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Equus asinus asinus GN=BMF (length=202 residues).
MESPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQVGMGAWGGG
ESSGDGGPGPASGLRLPSLKDKVLEFWPNAVVIPVDWMGPTA
>gnl|bcl2dbpro|A0A8C4MYJ3_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Equus asinus asinus GN=BAD (length=167 residues).
MFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGT
EDEGMEGEEPGPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFQALPRPKSAGTATQMRQSPSWTRAIQSWWDRNLGR
GGSAPSQ
>gnl|bcl2dbpro|A0A8C4MYJ3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Equus asinus asinus GN=BAD (length=205 residues).
MFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGT
EDEGMEGEEPGPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFQVSAGAARTPGPVLPGHLPLGCPIRVPVHVGTDVS
GPLPSHGPVPKSQGMLGSVVPGPLPSHRPVPESQGMPGSVVQTAP
>gnl|bcl2dbpro|A0A8C4PGL2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Equus asinus asinus GN=PMAIP1 (length=54 residues).
MPTRKARKSGQPSPTRAPAELEAECAIQIRRIGDKLNFRQKLLNLIAKLFRSGT
© 1998-2022Legal notice