Dataset for protein Bad of organism Equus asinus asinus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C4MYJ3_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Equus asinus asinus GN=BAD (length=167 residues).
MFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGT
EDEGMEGEEPGPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFQALPRPKSAGTATQMRQSPSWTRAIQSWWDRNLGR
GGSAPSQ
>gnl|bcl2dbpro|A0A8C4MYJ3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Equus asinus asinus GN=BAD (length=205 residues).
MFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGT
EDEGMEGEEPGPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFQVSAGAARTPGPVLPGHLPLGCPIRVPVHVGTDVS
GPLPSHGPVPKSQGMLGSVVPGPLPSHRPVPESQGMPGSVVQTAP
© 1998-2022Legal notice