Dataset for protein Bim of organism Dromaius novaehollandiae

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4J5J5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Dromaius novaehollandiae GN=BCL2L11 (length=99 residues).
MSVWGVNAIQADPAHGKPEIWIAQELRRIGDEFNASYCPRRVIFRFFFSVSFSANTLLPFPVSLFFFSTKTTSYMPPRCW
RKPYHQLSMRVLNGLEQVR
© 1998-2022Legal notice