Dataset for protein Bad of organism Dicentrarchus labrax

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8P4GSG1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Dicentrarchus labrax GN=BAD (length=168 residues).
MATNFTISSDSESEPSEEVEEGENNQSSTAEEQRAPQRHTLTLPELRMAGTGRIRLNSESHASTVSRDEELQARGEDEAG
TPTDGAPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMKKVRSAGSARQMHHSRSWWSYLFSHQETEGENNHH
ENHTHRTE
© 1998-2023Legal notice