Dataset for protein Bad of organism Chrysemys picta bellii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3IH53_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Chrysemys picta bellii GN=BAD (length=163 residues).
MHPLTPPFSCSAAPGRHAPSLSMFRIQEFPDEVFPGRGKESPLPPESQRGHTSGSKQPDTPTAEVRSRIGSDPPSLEPEV
QDEPGGAFRARSRSAPPILWAAMRYGRELRRMSDEFDVALQVLPRPKSAGTTSQLHRGNSWKETLQAWLGHRPARDAPPR
SSK
© 1998-2022Legal notice