Dataset for protein classical BH3-containing proteins of organism Bos indicus

[Download (right click)] [Alignment] [Repertoires]

12 sequence(s)

>gnl|bcl2dbpro|A0A4W2C9A8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Bos indicus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYRAGP
EDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLG
RGGSAPSQ
>gnl|bcl2dbpro|A0A4W2CDL0_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Bos indicus GN=PMAIP1 (length=54 residues).
MPGRRARKSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
>gnl|bcl2dbpro|A0A4W2CRW4_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Bos indicus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPASGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A4W2D2G6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Bos indicus GN=BCL2L11 (length=139 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
>gnl|bcl2dbpro|A0A4W2D2G6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Bos indicus GN=BCL2L11 (length=195 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCLQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAY
YPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
>gnl|bcl2dbpro|A0A4W2EII1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Bos indicus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQYQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A4W2EKD9_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Bos indicus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEER
QRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A4W2EKD9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Bos indicus GN=BBC3 (length=131 residues).
VRATAEAARACPCQLPGAFFSPWVPHQIRGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEERQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A4W2G3J8_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Bos indicus GN=BCL2L11 (length=195 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAY
YPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
>gnl|bcl2dbpro|A0A4W2G3J8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Bos indicus GN=BCL2L11 (length=139 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
>gnl|bcl2dbpro|A0A4W2GVZ3_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Bos indicus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A4W2INA4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Bos indicus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQYQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
© 1998-2020Legal notice