Dataset for protein Bmf of organism Bos indicus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A4W2EII1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Bos indicus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQYQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A4W2INA4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Bos indicus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQYQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
© 1998-2020Legal notice