Dataset for protein Puma of organism Bos indicus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A4W2EKD9_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Bos indicus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEER
QRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A4W2EKD9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Bos indicus GN=BBC3 (length=131 residues).
VRATAEAARACPCQLPGAFFSPWVPHQIRGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEERQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
© 1998-2020Legal notice