Dataset for protein LMW5-HL of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0C5AZD3_LMW5HL-      MEGEELIYHNIINEILVGYIKYYMNDISEHELSPYQQQIKKILTYYDDCL
A0A7R8V9Y5_LMW5HL-      MEGEELIYHNIINEILVGYIKYYMNDISEHELSPYQQQIKKILTYYDDCL
A9JKY0_LMW5HL-01        MEGEELIYHNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECL
A9JLP1_LMW5HL-01        MEGEELIYHNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECL
D0Q0E8_LMW5HL-01        MEGEELIYHNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECL
D4I5M9_LMW5HL-01        MEGEELIYHNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECL
P42485_LMW5HL-01        MEGEELIYHNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECL
                        ***********************:***********************:**

A0A0C5AZD3_LMW5HL-      NKQVTITFSLTSAQEIKTQFTEVVTELFKDLINWGRICGFIVFSARMAKY
A0A7R8V9Y5_LMW5HL-      NKQVTITFSLTSAQEIKTQFTEVVTELFKDLINWGRICGFIVFSARMAKY
A9JKY0_LMW5HL-01        NKQVIITFSLTSVQEIKTQFTGVVTELFKDLINWGRICGFIVFSAKMAKY
A9JLP1_LMW5HL-01        NKQVTITFSLTSVQEIKTQFTGVVTELFKDLINWGRICGFIVFSAKMAKY
D0Q0E8_LMW5HL-01        NKQVTITFSLTSVQEIKTQFTGVVTELFKDLINWGRICGFIVFSAKMAKY
D4I5M9_LMW5HL-01        NKQVTITFSLTSVQEIKTQFTGVVTELFKDLINWGRICGFIVFSAKMAKY
P42485_LMW5HL-01        NKQVTITFSLTSVQEIKTQFTGVVTELFKDLINWGRICGFIVFSAKMAKY
                        **** *******.******** ***********************.****

A0A0C5AZD3_LMW5HL-      CKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDIYSVI
A0A7R8V9Y5_LMW5HL-      CKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDIYSVI
A9JKY0_LMW5HL-01        CKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDMYSVI
A9JLP1_LMW5HL-01        CKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDMYSVI
D0Q0E8_LMW5HL-01        CKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDMYSVI
D4I5M9_LMW5HL-01        CKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDMYSVI
P42485_LMW5HL-01        CKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDMYSVI
                        *********************************************:****

A0A0C5AZD3_LMW5HL-      FNIKYFLSKFCNHMFLRSCVHLLRNCNLI
A0A7R8V9Y5_LMW5HL-      FNIKYFLSKFCNHMFLKSCVHLLRNCNLI
A9JKY0_LMW5HL-01        FNIKYFLSKFCNHMFFRSCVQLLRNCNLI
A9JLP1_LMW5HL-01        FNIKYFLSKFCNHMFFRSCVQLLRNCNLI
D0Q0E8_LMW5HL-01        FNIKYFLSKFCNHMFFRSCVQLLRNCNLI
D4I5M9_LMW5HL-01        FNIKYFLSKFCNHMFFRSCVQLLRNCNLI
P42485_LMW5HL-01        FNIKYFLSKFCNHMFFRSCVQLLRNCNLI
                        ***************:.***:********

© 1998-2022Legal notice