Dataset for protein BCL-2-like of organism Ursus maritimus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452UF16_BCL2L2-      ----------------------------------------MATPASAPDT
A0A452UF16_BCL2L2-      ----------------------------------------MATPASAPDT
A0A384D3U1_BCL2L1-      MSQSNRELVVDFLSYKLSQKG--YSWSQFSDVEENRTEAPEGTESEMETP
A0A452T603_BCL2-01      -------------------------------MAHAGRTGYDNRE------
A0A452U285_BCL2A1-      MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGYT
A0A452U285_BCL2A1-      MHTEIPPASARPMSHRPSPAGARLIWPXXXXXXXXXXGGWKMTDCEFGYT
                                                                          

A0A452UF16_BCL2L2-      RALVADFVGYKLRQKGYVCGAGPGEGPAA--------------DPLHQAM
A0A452UF16_BCL2L2-      RALVADFVGYKLRQKGYVCGAGPGEGPAA--------------DPLHQAM
A0A384D3U1_BCL2L1-      SAINGNPSWHLADS--------PAVNGATGHSSSLDAREVIPMAAVKQAL
A0A452T603_BCL2-01      --IVMKYIHYKLSQ--------RGYDPVP--------------PVVHLTL
A0A452U285_BCL2A1-      LTLAQDYVKHVLQI--------PQPGSAP--------------SRASQVL
A0A452U285_BCL2A1-      LTLAQDYVKHVLQI--------PQPGSAP--------------SRASQVL
                          :  .   :               . ..                   .:

A0A452UF16_BCL2L2-      RAAGDEFETRFRRTFSDLAAQLHVTPG-SAQQRFTQVSDELFQGG-PNWG
A0A452UF16_BCL2L2-      RAAGDEFETRFRRTFSDLAAQLHVTPG-SAQQRFTQVSDELFQGG-PNWG
A0A384D3U1_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHITPG-TAYQSFEQVVNELFRDG-VNWG
A0A452T603_BCL2-01      RQAGDDFSRRYRRDFAEMSSQLHLTPF-TARGRFATVVEELFRDG-VNWG
A0A452U285_BCL2A1-      RDVASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIINWG
A0A452U285_BCL2A1-      RDVASSVQGEVEKNLKPCLDSFDVVSVDSARTIFNQVMEKEFEDGIINWG
                        * ......    . :     .: :..  :*   *  * :: * .*  ***

A0A452UF16_BCL2L2-      RLVAFFVFGAALCAESVNKEMEPLVG--QVQEWMVAYLETRLADWIHSSG
A0A452UF16_BCL2L2-      RLVAFFVFGAALCAESVNKEMEPLVG--QVQEWMVAYLETRLADWIHSSG
A0A384D3U1_BCL2L1-      RIVAFFSFGGALCVESVDKEMQVLVS--RIATWMATYLNDHLEPWIQENG
A0A452T603_BCL2-01      RIVAFFEFGGVMCVESVNREMSPLVD--NIALWMTEYLNRHLHTWIQDNG
A0A452U285_BCL2A1-      RIVTIFAFEGILTKKLLQERISPDVDASRISYFVAEFITTNMREWIRQNG
A0A452U285_BCL2A1-      RIVTIFAFEGILTKKLLQERISPDVDASRISYFVAEFITTNMREWIRQNG
                        *:*::* * . :  : ::  :.  *.  .:  ::. ::  .:  **...*

A0A452UF16_BCL2L2-      GWELEAIK-ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIE
A0A452UF16_BCL2L2-      GWELEAIK-ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIE
A0A384D3U1_BCL2L1-      GWDTFVELYGNNAAAESRKGQERFNRWFLT--------------------
A0A452T603_BCL2-01      GWVGARPL-ECASGLHVSNLRLRIRGWSVG--------------------
A0A452U285_BCL2A1-      GWE----D-GFVKKFEPKSGWLTFLE-VMG--------------------
A0A452U285_BCL2A1-      GWSLLPPS-ASVKGCKRRAPGRSERR-AAA--------------------
                        **                                                

A0A452UF16_BCL2L2-      EKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKG
A0A452UF16_BCL2L2-      EKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKG
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
                                                                          

A0A452UF16_BCL2L2-      FAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRA
A0A452UF16_BCL2L2-      FAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRA
A0A384D3U1_BCL2L1-      --------------------------------------------------
A0A452T603_BCL2-01      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
A0A452U285_BCL2A1-      --------------------------------------------------
                                                                          

A0A452UF16_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A452UF16_BCL2L2-      RYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWFL--
A0A384D3U1_BCL2L1-      -------------------------GMTVAGVVLLGSLFSRK
A0A452T603_BCL2-01      -------------------------GLLGQGQTDEPGK----
A0A452U285_BCL2A1-      -------------------------KICEMFSLLKQYY----
A0A452U285_BCL2A1-      -------------------------TFSAGSSVRE-------
                                                                  

© 1998-2020Legal notice