Dataset for protein Bcl-xL of organism Sphaeramia orbicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672Z262_BCL2L1-      MSHSNRELVEFFICYKLSQKNYPSSL--LRPDDARTEGDKAN-------T
A0A673BZP5_BCL2L1-      -MSQNRELVVFYINYKLSQRNYPINHIGLIEPPSRTDGGEAGLGEEQRVS
                           .***** *:* *****.*** .   *    :**:*.:*.       :

A0A672Z262_BCL2L1-      TVSNGLLANSRNG---GGQAVVSLPPSGDVDAVKAALQDSADEFELLYTQ
A0A673BZP5_BCL2L1-      THANGTFNGTSPGTPPASPVRQRLPSTTNLDSVKEALRDSANEFELRYAR
                        * :** : .:  *   .. .   **.: ::*:** **.***:**** *:.

A0A672Z262_BCL2L1-      AFSGLSSQLDITPDTAYQSFKSVMDEVFKDGVNWGRIVGLFAFGGVLCVE
A0A673BZP5_BCL2L1-      AFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVE
                        ***.* .** *** ******:.******.****************.****

A0A672Z262_BCL2L1-      CAEKDMSELVPRIADWMTTYLDEHISPWIESAGGWDSFGEIFGQSAAAEA
A0A673BZP5_BCL2L1-      CVEKEMSPLVGRIVEWMTVYLDNHIQGWIQSQGGWERFAEIFGQDAAAEG
                        *.**:** ** **.:***.***:**. **:* ***: *.*****.****.

A0A672Z262_BCL2L1-      RRSGETLKRWLLVGVVLLTGVLIGVLVAKKQ-
A0A673BZP5_BCL2L1-      RRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
                        *** *::*.***.*:.*:***::* *:*:*. 

© 1998-2020Legal notice