Dataset for protein Bcl-xL of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671K7W7_BCL2L1-      MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGT
A0A671K7W7_BCL2L1-      MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEAAAGT
A0A671QPE4_BCL2L1-      MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEEAAGT
                        ********************************************* ****

A0A671K7W7_BCL2L1-      TNLINGSLNGTSTGSTGTPPRSPTSTPQHQTNGTGGLDAVKEALRDSANE
A0A671K7W7_BCL2L1-      TNLINGSLNGTSTGSTGTPPRSPTSTPQHQTNGTGGLDAVKEALRDSANE
A0A671QPE4_BCL2L1-      TTLVNGSLNGTSTGSTGTPPRSPASTPQRQTNGTGGLDAVKEALRDSANE
                        *.*:*******************:****.*********************

A0A671K7W7_BCL2L1-      FELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAF
A0A671K7W7_BCL2L1-      FELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAF
A0A671QPE4_BCL2L1-      FELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAF
                        **************************************************

A0A671K7W7_BCL2L1-      GGALCVECVEKEMSPLVGSIAEWMTVYLDNKIQPWIQSQGGWERFAEIFG
A0A671K7W7_BCL2L1-      GGALCVECVEKEMSPLVGSIAEWMTVYLDNKIQPWIQSQGGWERFAEIFG
A0A671QPE4_BCL2L1-      GGALCVECVEKEMSPLVGNIADWMTVYLDNKIQPWIQSQGGWERFAEIFG
                        ******************.**:****************************

A0A671K7W7_BCL2L1-      KDAVAESRKSQENFKKWLLVGMTLLTGVVVGSLIAQKRL
A0A671K7W7_BCL2L1-      KDAVAESRKSQENFKKWLLVGMTLLTGVVVGSLIAQKRL
A0A671QPE4_BCL2L1-      KDAAAESRKSQENFKKWLLAGMTLLTGVVGGSLIAQKRL
                        ***.***************.********* *********

© 1998-2020Legal notice