Dataset for protein Bcl2l10 of organism Papio anubis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A096NM44_BCL2L10      ---------MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRS
A0A8I5NQD2_BCL2L10      TVESLRGRTMADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRS
                                 *****************************************

A0A096NM44_BCL2L10      AAARLRQLHRSFFSAYRGYPGNRVELVALMAEAVLSDSPGPTWGRVVSLV
A0A8I5NQD2_BCL2L10      AAARLRQLHRSFFSAYRGYPGNRVELVALMAEAVLSDSPGPTWGRVVSLV
                        **************************************************

A0A096NM44_BCL2L10      TFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARDCQRLVALLSSRLAG
A0A8I5NQD2_BCL2L10      TFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARDCQRLVALLSSRLAG
                        **************************************************

A0A096NM44_BCL2L10      QHRAWLQAQGGWDGFCHFFRSPFPLAFWRKLLIQAFLACLLATAFGYLWT
A0A8I5NQD2_BCL2L10      QHRAWLQAQGGWDGFCHFFRSPFPLAFWRKLLIQAFLACLLATAFGYLWT
                        **************************************************

A0A096NM44_BCL2L10      RLL
A0A8I5NQD2_BCL2L10      RLL
                        ***

© 1998-2023Legal notice