Dataset for protein Bcl-xL of organism Pan paniscus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8Z9D7_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
A0A2R8Z9D7_BCL2L1-      --------------------------------------------------
                                                                          

A0A2R8Z9D7_BCL2L1-      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A2R8Z9D7_BCL2L1-      -----MWKRTGLRPQKG-----------------------------LNRR
                              *: :.  . :*                             :: *

A0A2R8Z9D7_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A2R8Z9D7_BCL2L1-      WRPPVPSMATH----PGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                        :* ....::::    ***********************************

A0A2R8Z9D7_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A2R8Z9D7_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
                        **************************************************

A0A2R8Z9D7_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A2R8Z9D7_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                        *********************************

© 1998-2020Legal notice