Dataset for protein Mcl-1 of organism Oreochromis niloticus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3KXG5_MCL1-01      --MFSLN----CCLSEW-------------------CPNNDVGFIDNWETLCRKPGLVRR
I3JHR5_MCL1-02      MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSNGIVSNGTPKR
I3JHR5_MCL1-03      MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSNGIVSNGTPKR
I3JHR5_MCL1-01      MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSNGIVSNGTPKR
                       * :.    * : ::                   .*:* .*  .: ..   . *  .*

I3KXG5_MCL1-01      DGIHPTLDGAALISRNL----EDGSLPSTPE-------------ETKLIIHSFLGDFTGL
I3JHR5_MCL1-02      PNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGESDEELERETKLLIHSFLGDFTGL
I3JHR5_MCL1-03      PNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGESDEELERETKLLIHSFLGDFTGL
I3JHR5_MCL1-01      PNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGESDEELERETKLLIHSFLGDFTGL
                     .   . .  .  :. :    **********             ****:***********

I3KXG5_MCL1-01      SQPQRKETKALKMMKRVVADVLEKHRYAYNGMINKLSLDEREEDMSF---VAKSLFGDHT
I3JHR5_MCL1-02      SQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDERHEDMSFVGAVAKSLFADHT
I3JHR5_MCL1-03      SQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDERHEDMSFVGAVAKSLFADHT
I3JHR5_MCL1-01      SQPQRKETKALKTMKRVVADVLEKHRYAYNGMINKLSLDERHEDMSFVGAVAKSLFADHT
                    ************ **************************** *****   ******.***

I3KXG5_MCL1-01      TNWGRIVSFVAFGAVVSQHLKEKGRDNCVVLVSQEISAYLLSEQRDWIIKNNAWDGFVAF
I3JHR5_MCL1-02      TNWGRIVSFVAFGAVVSQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEF
I3JHR5_MCL1-03      TNWGRIVSFVAFGAVVSQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEF
I3JHR5_MCL1-01      TNWGRIVSFVAFGAVVSQHLKEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEF
                    *****************************.*****:************:********* *

I3KXG5_MCL1-01      VRVADPESIVRNT------LMAFAGFACIGATLALLIR----------------------
I3JHR5_MCL1-02      FRVADPESTVRNT------LMAFAGFAGIGATLALLIRTNTHSGLRKKWRVSRHGDDPQQ
I3JHR5_MCL1-03      FRVADPESTTREVEWTKGKMFQITLFNSQRSIFAKRCHNKKEKDIF--------------
I3JHR5_MCL1-01      FRVADPESTVRNT------LMAFAGFAGIGATLA----------LL--------------
                    .******* .*:.      :: :: *    : :*                          

I3KXG5_MCL1-01      -----------------------------
I3JHR5_MCL1-02      ASPNLLLWLMLSTTQVTPVVNCEEHTGRQ
I3JHR5_MCL1-03      ----FPFLLVFF-----------------
I3JHR5_MCL1-01      ----IRFWDALL-----------------
                                                 

© 1998-2020Legal notice