Dataset for protein Mcl-1 of organism Oreochromis niloticus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3KXG5_MCL1-01          --MFSLN----CCLSEW-------------------CPNNDVGFIDNWET
A0A669C7T2_MCL1-02      MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSN
A0A669C7T2_MCL1-01      MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSN
A0A669C7T2_MCL1-03      MTNFLMSKRNQCTFIDYLLPQNGVLEGPMHYGSGKSSPQNATGSSKDSSN
                           * :.    * : ::                   .*:* .*  .: ..

I3KXG5_MCL1-01          LCRKPGLVRRDGIHPTLDGAALISRNL----EDGSLPSTPE---------
A0A669C7T2_MCL1-02      GIVSNGTPKRPNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGESDE
A0A669C7T2_MCL1-01      GIVSNGTPKRPNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGESDE
A0A669C7T2_MCL1-03      GIVSNGTPKRPNNLGVTSTNGYTTKAIRDREEDGSLPSTPEYHLDGESDE
                           . *  .* .   . .  .  :. :    **********         

I3KXG5_MCL1-01          ----ETKLIIHSFLGDFTGLSQPQRKETKALKMMKRVVADVLEKHRYAYN
A0A669C7T2_MCL1-02      ELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYN
A0A669C7T2_MCL1-01      ELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYN
A0A669C7T2_MCL1-03      ELERETKLLIHSFLGDFTGLSQPQRKETKALKTMKRVVADVLEKHRYAYN
                            ****:*********************** *****************

I3KXG5_MCL1-01          GMINKLSLDEREEDMSF---VAKSLFGDHTTNWGRIVSFVAFGAVVSQHL
A0A669C7T2_MCL1-02      GMINKLSLDERHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHL
A0A669C7T2_MCL1-01      GMINKLSLDERHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHL
A0A669C7T2_MCL1-03      GMINKLSLDERHEDMSFVGAVAKSLFADHTTNWGRIVSFVAFGAVVSQHL
                        *********** *****   ******.***********************

I3KXG5_MCL1-01          KEKGRDNCVVLVSQEISAYLLSEQRDWIIKNNAWDGFVAFVRVADPESIV
A0A669C7T2_MCL1-02      KEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEFFRVADPESTV
A0A669C7T2_MCL1-01      KEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEFFRVADPESTV
A0A669C7T2_MCL1-03      KEKGRDNCVALVSQEVSAYLLSEQRDWIVKNNAWDGFVEFFRVADPESTT
                        *********.*****:************:********* *.******* .

I3KXG5_MCL1-01          RNT------LMAFAGFACIGATLALLIR----------------------
A0A669C7T2_MCL1-02      RNT------LMAFAGFAGIGATLALLIRTNTHSGLRKKWRVSRHGDDPQQ
A0A669C7T2_MCL1-01      RNT------LMAFAGFAGIGATLA----------LL--------------
A0A669C7T2_MCL1-03      REVEWTKGKMFQITLFNSQRSIFAKRCHNKKEKDIF--------------
                        *:.      :: :: *    : :*                          

I3KXG5_MCL1-01          -----------------------------
A0A669C7T2_MCL1-02      ASPNLLLWLMLSTTQVTPVVNCEEHTGRQ
A0A669C7T2_MCL1-01      ----IRFWDALL-----------------
A0A669C7T2_MCL1-03      ----FPFLLVFF-----------------
                                                     

© 1998-2022Legal notice