Dataset for protein Bcl-w of organism Nannospalax galili

[Download (right click)] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C6RJE0_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A8C6RJE0_BCL2L2-02      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                          **************************************************

A0A8C6RJE0_BCL2L2-01      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A8C6RJE0_BCL2L2-02      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                          **************************************************

A0A8C6RJE0_BCL2L2-01      VFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGW-ELEAI
A0A8C6RJE0_BCL2L2-02      VFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWAEFTAL
                          ******************************************** *: *:

A0A8C6RJE0_BCL2L2-01      KARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADAR
A0A8C6RJE0_BCL2L2-02      YG--DGALEEARRLRE---------------------------GNWASVR
                           .      ***.:*:*                              *..*

A0A8C6RJE0_BCL2L2-01      SIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSD
A0A8C6RJE0_BCL2L2-02      TVLTGAVALGALV-------------------------------------
                          :: .* *  ** .                                     

A0A8C6RJE0_BCL2L2-01      KESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTN
A0A8C6RJE0_BCL2L2-02      --------------------------------------------------
                                                                            

A0A8C6RJE0_BCL2L2-01      YNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A8C6RJE0_BCL2L2-02      -------------------------TVGAFFASK
                                                    . ::::. 

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice