Dataset for protein Bfl1 of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O55178_BCL2A1-01      MAEYELMHIHSLAEHYLQYVLQVPAFESAPSQAFRVLQRVAFSVQKEVGK
Q07440_BCL2A1-01      MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEK
O55177_BCL2A1-02      MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEK
Q8K164_BCL2A1-01      MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEK
Q4FK02_BCL2A1-01      MSEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEK
                      *:* *:*:***********************:* ************** *

O55178_BCL2A1-01      NLKSYLDDFHVESIDTTRIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLL
Q07440_BCL2A1-01      NLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLL
O55177_BCL2A1-02      NLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLL
Q8K164_BCL2A1-01      NLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLL
Q4FK02_BCL2A1-01      NLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLL
                      ****************:*********************************

O55178_BCL2A1-01      KKTSTRADCPGC--------------------------------------
Q07440_BCL2A1-01      KKLPQEQIALDVCAYKQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEP
O55177_BCL2A1-02      KKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEP
Q8K164_BCL2A1-01      KKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEP
Q4FK02_BCL2A1-01      KKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEP
                      ** .    . .                                       

O55178_BCL2A1-01      -----TCLQTSFQFWGRIHNE-
Q07440_BCL2A1-01      KSGWLTFLQMTGQIWEMLFLLK
O55177_BCL2A1-02      KSGWLTFLQMTGQFWEMLFLLK
Q8K164_BCL2A1-01      KSGWLTFLQMTGQIWEMLFLLK
Q4FK02_BCL2A1-01      KSGWLTFLQMTGQFWEMLFLLK
                           * ** : *:*  :.   

© 1998-2022Legal notice