Dataset for protein Mcl-1 of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F8GAQ2_MCL1-01      MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPTVESTP
A0A5F8GAQ2_MCL1-02      MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPTVESTP
A0A5F8GAQ2_MCL1-03      MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPTVESTP
                        **************************************************

A0A5F8GAQ2_MCL1-01      PQRDGGEVETGTAGAGLIGGGIRASPPNPVSPGARGVARPAPIGAEAPDV
A0A5F8GAQ2_MCL1-02      PQRDGGEVETGTAGAGLIGGGIRASPPNPVSPGARGVARPAPIGAEAPDV
A0A5F8GAQ2_MCL1-03      PQRDGGEVETGTAGAGLIGGGIRASPPNPVSPGARGVARPAPIGAEAPDV
                        **************************************************

A0A5F8GAQ2_MCL1-01      TTDPMPSLFAPGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPGKRPSR
A0A5F8GAQ2_MCL1-02      TTDPMPSLFAPGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPGKRPSR
A0A5F8GAQ2_MCL1-03      TTDPMPSLFAPGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPGKRPSR
                        **************************************************

A0A5F8GAQ2_MCL1-01      LAVLEIAREGGDSPNGSLPSTPPPAEEDEEEDELYGQSLELISRYLREQA
A0A5F8GAQ2_MCL1-02      LAVLEIAREGGDSPNGSLPSTPPPAEEDEEEDELYGQSLELISRYLREQA
A0A5F8GAQ2_MCL1-03      LAVLEIAREGGDSPNGSLPSTPPPAEEDEEEDELYGQSLELISRYLREQA
                        **************************************************

A0A5F8GAQ2_MCL1-01      VGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKLDIKNEEDIKA
A0A5F8GAQ2_MCL1-02      VGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKLDIKNEEDIKA
A0A5F8GAQ2_MCL1-03      VGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKLDIKNEEDIKA
                        **************************************************

A0A5F8GAQ2_MCL1-01      VSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESIT
A0A5F8GAQ2_MCL1-02      VSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESIT
A0A5F8GAQ2_MCL1-03      VSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESIT
                        **************************************************

A0A5F8GAQ2_MCL1-01      DVLVKTKRDWLIKQKGWKGLLAQDTEEATRTGDPCAPSSAYLLLCAEPLF
A0A5F8GAQ2_MCL1-02      DVLVKTKRDWLIKQKGWSGKERVDPRGLVSGG------------N-----
A0A5F8GAQ2_MCL1-03      DVLVKTKRDWLIKQKGWEGFVEFFHVQDLEGG------------IRNVLL
                        *****************.*            *                  

A0A5F8GAQ2_MCL1-01      WWCQLTASGCHVPDKPRNVLTEERKWAASLQRSHNKFSTSMITHGL
A0A5F8GAQ2_MCL1-02      ----------------------------------------------
A0A5F8GAQ2_MCL1-03      AFAGVAGVGAGLAYLIR-----------------------------
                                                                      

© 1998-2022Legal notice