Dataset for protein Mcl-1 of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6ZMX1_MCL1-01      MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVET
F6ZMX1_MCL1-02      MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVET
F6ZMX1_MCL1-03      MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPTVESTPPQRDGGEVET
                    ************************************************************

F6ZMX1_MCL1-01      GTAGAGLIGGGIRASPPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLFAPGRCSSAPAE
F6ZMX1_MCL1-02      GTAGAGLIGGGIRASPPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLFAPGRCSSAPAE
F6ZMX1_MCL1-03      GTAGAGLIGGGIRASPPNPVSPGARGVARPAPIGAEAPDVTTDPMPSLFAPGRCSSAPAE
                    ************************************************************

F6ZMX1_MCL1-01      VADGAADVPMCPEEELDGYEPEPPGKRPSRLAVLEIAREGGDSPNGSLPSTPPPAEEDEE
F6ZMX1_MCL1-02      VADGAADVPMCPEEELDGYEPEPPGKRPSRLAVLEIAREGGDSPNGSLPSTPPPAEEDEE
F6ZMX1_MCL1-03      VADGAADVPMCPEEELDGYEPEPPGKRPSRLAVLEIAREGGDSPNGSLPSTPPPAEEDEE
                    ************************************************************

F6ZMX1_MCL1-01      EDELYGQSLELISRYLREQAVGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKL
F6ZMX1_MCL1-02      EDELYGQSLELISRYLREQAVGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKL
F6ZMX1_MCL1-03      EDELYGQSLELISRYLREQAVGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKL
                    ************************************************************

F6ZMX1_MCL1-01      DIKNEEDIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESIT
F6ZMX1_MCL1-02      DIKNEEDIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESIT
F6ZMX1_MCL1-03      DIKNEEDIKAVSRVATHVFSDGITNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESIT
                    ************************************************************

F6ZMX1_MCL1-01      DVLVKTKRDWLIKQKGWKGLLAQDTEEATRTGDPCAPSSAYLLLCAEPLFWWCQLTASGC
F6ZMX1_MCL1-02      DVLVKTKRDWLIKQKGWSGKERVDPRGLVSGG------------N---------------
F6ZMX1_MCL1-03      DVLVKTKRDWLIKQKGWEGFVEFFHVQDLEGG------------IRNVLLAFAGVAGVGA
                    *****************.*            *                            

F6ZMX1_MCL1-01      HVPDKPRNVLTEERKWAASLQRSHNKFSTSMITHGL
F6ZMX1_MCL1-02      ------------------------------------
F6ZMX1_MCL1-03      GLAYLIR-----------------------------
                                                        

© 1998-2020Legal notice