Dataset for protein BCL-2-like of organism Mastacembelus armatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3MX20_BCL2L1-      ----MSQNRELVVFYIKYKLSQRNY---PLIY------IELNEQQNRTDG
A0A3Q3M6G2_MCL1-02      MSFIPSTRRAALIPGVMIVLPQDGVLEGPVHYDSRDPSTQFTLDSRNGNG
A0A3Q3M6G2_MCL1-01      MSFIPSTRRAALIPGVMIVLPQDGVLEGPVHYDSRDPSTQFTLDSRNGNG
                             * .*  ::  :   *.* .    *: *       ::. :... :*

A0A3Q3MX20_BCL2L1-      GEAESGEEQRIATHANGTF-------------NGTSPGTP--------PA
A0A3Q3M6G2_MCL1-02      GTANPKRPKNLEVSSTNGYATKSIVADTDDIEDGSLPCTPELQSDSEAPS
A0A3Q3M6G2_MCL1-01      GTANPKRPKNLEVSSTNGYATKSIVADTDDIEDGSLPCTPELQSDSEAPS
                        * *:.   :.: . :.. :             :*: * **        *:

A0A3Q3MX20_BCL2L1-      SPLRQEHLQSTASLDAVK-------------------EALRDSANEFELR
A0A3Q3M6G2_MCL1-02      CPAGDEVLENDTRQLICQYLKDVSGLSKPRWHDSKALSTMKRVVEDLLEK
A0A3Q3M6G2_MCL1-01      CPAGDEVLENDTRQLICQYLKDVSGLSKPRWHDSKALSTMKRVVEDLLEK
                        .*  :* *:. :     :                   .::.  .:::  .

A0A3Q3MX20_BCL2L1-      YARAFSDLHNQLHITPATAYQSF-ESVMDEVFRDG-VNWGRIIGLFAFGG
A0A3Q3M6G2_MCL1-02      YRYTYNGMINKLSLDDRGDDVRFVSTVAKSLFADGTTNWGRIASLVAFGA
A0A3Q3M6G2_MCL1-01      YRYTYNGMINKLSLDDRGDDVRFVSTVAKSLFADGTTNWGRIASLVAFGA
                        *  ::..: *:* :        * .:* ..:* ** .***** .*.***.

A0A3Q3MX20_BCL2L1-      ALCVECVEKEMSPLVGRIVEWMTLYLDNHIEPWIQSQGGWEHFAEIFGQD
A0A3Q3M6G2_MCL1-02      VVCQYLKEKGRGDCVELVGQEISTYLLSDQRDWLVKNNSWDGFVEFFRVA
A0A3Q3M6G2_MCL1-01      VVCQYLKEKGRGDCVELVGQEISTYLLSDQRDWLVKNNSWDGFVEFFRVA
                        .:*    **  .  *  : : :: ** .    *: .:..*: *.*:*   

A0A3Q3MX20_BCL2L1-      AAAESRRSQENFKKWLLAGMTLVTGVVVGSLIAQKRL-------------
A0A3Q3M6G2_MCL1-02      DPESTVR-----HTLMAVAGVAGLGATLALLISYCGVM------------
A0A3Q3M6G2_MCL1-01      DPESTVR-----HTLMAVAGVAGLGATLALLISRNNKMLTSQSAISAPVS
                         . .: *     :. : .. .   *..:. **:                 

A0A3Q3MX20_BCL2L1-      -
A0A3Q3M6G2_MCL1-02      -
A0A3Q3M6G2_MCL1-01      A
                         

© 1998-2022Legal notice