Dataset for protein BCL-2-like of organism Mastacembelus armatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3MEY1_BCL2-10      MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A7N8WMH7_BCL2L10      MSCG----------LWKETLALAEDY--------------LSLCCTSPQS
A0A3Q3S6A5_MCL1-01      -----------------------MSFIPSTRRAALIPGVMIVLPQDGVLE
A0A3Q3S6A5_MCL1-02      -----------------------MSFIPSTRRAALIPGVMIVLPQDGVLE
A0A3Q3MEY1_BCL2-03      MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-04      MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-05      MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-09      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-06      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-08      ----------------------------THLLDLWVYDLLTLL-------
A0A3Q3MEY1_BCL2-02      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-07      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-01      ---------------------------MANECNRNIVEKYICHKLSKRGY
A0A3Q3MX20_BCL2L1-      -----------------------------MSQNRELVVFYIKYKLSQRNY
A0A3Q3NFM4_BCL2L1-      ----------------------------MSYSNRELVEFFISYKLSQKNY
                                                                          

A0A3Q3MEY1_BCL2-10      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQ---------GA
A0A7N8WMH7_BCL2L10      VPPPPSESAAAM-----------------RCLAQKMERQHQARFHSLTQT
A0A3Q3S6A5_MCL1-01      GPVHYDSRDPSTQFTLDSRNGNGGTANPKRPKNLEVSST---------NG
A0A3Q3S6A5_MCL1-02      GPVHYDSRDPSTQFTLDSRNGNGGTANPKRPKNLEVSST---------NG
A0A3Q3MEY1_BCL2-03      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQ---------GA
A0A3Q3MEY1_BCL2-04      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQ---------GA
A0A3Q3MEY1_BCL2-05      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQ---------GA
A0A3Q3MEY1_BCL2-09      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQ---------GA
A0A3Q3MEY1_BCL2-06      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQ---------GA
A0A3Q3MEY1_BCL2-08      ----------NFQVT-------GGSSGIGKCIAIECYRQ---------GA
A0A3Q3MEY1_BCL2-02      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQ---------GA
A0A3Q3MEY1_BCL2-07      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQ---------GA
A0A3Q3MEY1_BCL2-01      VWGFHNVQDEDAANN-------GSVVAPPPTV-----VR---------RC
A0A3Q3MX20_BCL2L1-      PLIYIELNEQQNRTD-------GGEAESGEEQRIATHAN---------GT
A0A3Q3NFM4_BCL2L1-      PTSLLRPEDAGGRTE-------GDMTGAAATNGLL--VN---------SR
                                                                          

A0A3Q3MEY1_BCL2-10      FITLVARDEPGCLYSQ-----------------------------VK---
A0A7N8WMH7_BCL2L10      FLKQCGPDPCSSLRKV-----------------------------IEELV
A0A3Q3S6A5_MCL1-01      YATKSIVADTDDIEDG-----------SLPCTPELQSDSEAPSCPAGDEV
A0A3Q3S6A5_MCL1-02      YATKSIVADTDDIEDG-----------SLPCTPELQSDSEAPSCPAGDEV
A0A3Q3MEY1_BCL2-03      FITLVARDETKLLQAK--KEVEKFAINDKQVVLCISVDVSSDYNQVESVI
A0A3Q3MEY1_BCL2-04      FITLVARDEPMPFNLRFHKTVYNFLIQVV---LCISVDVSSDYNQVESVI
A0A3Q3MEY1_BCL2-05      FITLVARDETKLLQAK--KEVEKFAINDK---QVWVYLSRSDF----FAV
A0A3Q3MEY1_BCL2-09      FITLVARDETKLLQAK--KEVEKFAINDKQVVLCISVDVSSDYNQVESVI
A0A3Q3MEY1_BCL2-06      FITLVARDETKLLQAK--KEVEKFAINDKQVVLCISVDVSSDYNQVESVI
A0A3Q3MEY1_BCL2-08      FITLVARDETKLLQAK--KEVEKFAINDKQVVLCISVDVSSDYNQVESVI
A0A3Q3MEY1_BCL2-02      FITLVARDETKLLQAK--KEVEKFAINDKQVVLCISVDVSSDYNQVESVI
A0A3Q3MEY1_BCL2-07      FITLVARDETKLLQAK--KEVEKFAINDKQVVLCISVDVSSDYNQVESVI
A0A3Q3MEY1_BCL2-01      RDASTGPDSESIPQLC------------------RGLPQSDPQAAIHRVL
A0A3Q3MX20_BCL2L1-      FNGTSPGTPPASPLRQ------------------EHLQSTASLDAVKEAL
A0A3Q3NFM4_BCL2L1-      YVSGRPGMSSS---------------------------PHGGVEAVKAAL
                                                                          

A0A3Q3MEY1_BCL2-10      -NAQEKLGPVDMLVNCAGTSVSGKFEE------------VEVDRFKIITM
A0A7N8WMH7_BCL2L10      ADGHLNWGRVVSLFTFTGVLSRQLMEQKGMKPGLDSGKGQELGQGPESCR
A0A3Q3S6A5_MCL1-01      LENDTRQLICQYLKDVSGLSKPRWHDS------------KALSTMKRVVE
A0A3Q3S6A5_MCL1-02      LENDTRQLICQYLKDVSGLSKPRWHDS------------KALSTMKRVVE
A0A3Q3MEY1_BCL2-03      KQAQEKLGPVDMLVNCAGTSVSGKFEE------------VEVDRFKKLME
A0A3Q3MEY1_BCL2-04      KQAQEKLGPVDMLVNCAGTSVSGKFEE------------VEVDRFKKLME
A0A3Q3MEY1_BCL2-05      VQAQEKLGPVDMLVNCAGTSVSGKFEE------------VEVDRFKKLME
A0A3Q3MEY1_BCL2-09      KQAQEKLGPVDMLVNCAGTSVSGKFEE------------VEVDRFKKLME
A0A3Q3MEY1_BCL2-06      KQAQEKLGPVDMLVNCAGTSVSGKFEE------------VEVDRFK----
A0A3Q3MEY1_BCL2-08      KQAQEKLGPVDMLVNCAGTSVSGKFEE------------VEVDRFKKLME
A0A3Q3MEY1_BCL2-02      KQAQEKLGPVDMLVNCAGTSVSGKFEE------------VEVDRFKKLME
A0A3Q3MEY1_BCL2-07      KQAQEKLGPVDMLVNCAGTSVSGKFEE------------VEVDRFKKLME
A0A3Q3MEY1_BCL2-01      REAGDELERLYQPDFTEMSRQLYLTST------------TAQRRFAEVID
A0A3Q3MX20_BCL2L1-      RDSANEFELRYARAFSDLHNQLHITPA------------TAYQSFESVMD
A0A3Q3NFM4_BCL2L1-      RDSAEEFELLFTQAFSDLSSQLDITPD------------TAYHSFKSVMD
                         :                                                

A0A3Q3MEY1_BCL2-10      --------------------------------------------------
A0A7N8WMH7_BCL2L10      --------------------------------------------------
A0A3Q3S6A5_MCL1-01      ----------------------------------------DLLEKYRYTY
A0A3Q3S6A5_MCL1-02      ----------------------------------------DLLEKYRYTY
A0A3Q3MEY1_BCL2-03      VNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFAL
A0A3Q3MEY1_BCL2-04      VNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFAL
A0A3Q3MEY1_BCL2-05      VNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFAL
A0A3Q3MEY1_BCL2-09      VNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFAL
A0A3Q3MEY1_BCL2-06      --------------------------------------------------
A0A3Q3MEY1_BCL2-08      VNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFAL
A0A3Q3MEY1_BCL2-02      VNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFAL
A0A3Q3MEY1_BCL2-07      VNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFAL
A0A3Q3MEY1_BCL2-01      ELFRDGVNWGRI----------------------IAFFEFGGTVCVECAA
A0A3Q3MX20_BCL2L1-      EVFRDGVNWGRI----------------------IGLFAFGGALCVECVE
A0A3Q3NFM4_BCL2L1-      EVFKDGVNWGRI----------------------VGLFAFGGVLCVECIE
                                                                          

A0A3Q3MEY1_BCL2-10      --GLF---------------------------------------------
A0A7N8WMH7_BCL2L10      --GLA---------------------------------------------
A0A3Q3S6A5_MCL1-01      N-GMINKLSLDDRGDDVRFVSTVAKSLFADGTTNWGRI----ASLVAFGA
A0A3Q3S6A5_MCL1-02      N-GMINKLSLDDRGDDVRFVSTVAKSLFADGTTNWGRI----ASLVAFGA
A0A3Q3MEY1_BCL2-03      R-GLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETS
A0A3Q3MEY1_BCL2-04      R-GLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETS
A0A3Q3MEY1_BCL2-05      R-GLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETS
A0A3Q3MEY1_BCL2-09      R-GLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETS
A0A3Q3MEY1_BCL2-06      -----------IKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETS
A0A3Q3MEY1_BCL2-08      R-GLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETS
A0A3Q3MEY1_BCL2-02      R-GLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETS
A0A3Q3MEY1_BCL2-07      R-GLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETS
A0A3Q3MEY1_BCL2-01      KEEMTSQVDNIAEWMTEYLNGPLNSWIQDNG-------------------
A0A3Q3MX20_BCL2L1-      K-EMSPLVGRIVEWMTLYLDNHIEPWIQSQG-------------------
A0A3Q3NFM4_BCL2L1-      K-NMSALVSRIADWMTMYLDEHISPWIESQG-------------------
                                                                          

A0A3Q3MEY1_BCL2-10      --------------------------------------------------
A0A7N8WMH7_BCL2L10      --------------------------------------------------
A0A3Q3S6A5_MCL1-01      VVCQ-------YLKEKGRGDCVELVGQEISTYLLSDQRDWLVKNNSWD--
A0A3Q3S6A5_MCL1-02      VVCQ-------YLKEKGRGDCVELVGQEISTYLLSDQRDWLVKNNSWD--
A0A3Q3MEY1_BCL2-03      GVCQPEQVAKIVVRDAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEA
A0A3Q3MEY1_BCL2-04      GVCQPEQVAKIVVRDAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEA
A0A3Q3MEY1_BCL2-05      GVCQPEQVAKIVVRDAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEA
A0A3Q3MEY1_BCL2-09      GVCQPEQVAKIVVRDAI---------------------------------
A0A3Q3MEY1_BCL2-06      GVCQPEQVAKIVVRDAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEA
A0A3Q3MEY1_BCL2-08      GVCQPEQVAKIVVRDAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEA
A0A3Q3MEY1_BCL2-02      GVCQPEQVAKIVVRDAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEA
A0A3Q3MEY1_BCL2-07      GVCQPEQVAKIVVRDAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEA
A0A3Q3MEY1_BCL2-01      ------------------------------GWDAFVEMYDRQRESVFSCS
A0A3Q3MX20_BCL2L1-      ------------------------------GWEHFAEIFGQDAAAESRRS
A0A3Q3NFM4_BCL2L1-      ------------------------------GWDCFAEIFGRDAAAEARRS
                                                                          

A0A3Q3MEY1_BCL2-10      --------------------------RTIALFYLG-----------SFDS
A0A7N8WMH7_BCL2L10      --------------------------ETIAD-YLGEEKKDWLQENDGWEG
A0A3Q3S6A5_MCL1-01      --------------------------GFVEFFRVA-----------DPES
A0A3Q3S6A5_MCL1-02      --------------------------GFVEFFRVA-----------DPES
A0A3Q3MEY1_BCL2-03      LQQIITMGLF----------------RTIALFYLG-----------SFDS
A0A3Q3MEY1_BCL2-04      LQQIITMGLF----------------RTIALFYLG-----------SFDS
A0A3Q3MEY1_BCL2-05      LQQIITMGLF----------------RTIALFYLG-----------SFDS
A0A3Q3MEY1_BCL2-09      ----ITMGLF----------------RTIALFYLG-----------SFDS
A0A3Q3MEY1_BCL2-06      LQQIITMGLF----------------RTIALFYLG-----------SFDS
A0A3Q3MEY1_BCL2-08      LQQIITMGLF----------------RTIALFYLG-----------SFDS
A0A3Q3MEY1_BCL2-02      LQQDAFVEMYDRQRESVFSCSWPSIKTVFGLAALG-----------AASI
A0A3Q3MEY1_BCL2-07      LQQIITMGLF----------------RTIALFYLG-----------SFDS
A0A3Q3MEY1_BCL2-01      WPSI----------------------KTVFGLAAL-----------GAAS
A0A3Q3MX20_BCL2L1-      QENF----------------------KKWLLAGMT-----------LVTG
A0A3Q3NFM4_BCL2L1-      QETL----------------------RRWLLVGVA-----------LLTG
                                                                          

A0A3Q3MEY1_BCL2-10      IVRRCMIQREQSKSADKRE-----------------------
A0A7N8WMH7_BCL2L10      FCKFSHSAREVSHDSSMKTALFAAAGVGLAGLTFLLVR----
A0A3Q3S6A5_MCL1-01      TVRHTLMAVAGVAGLGATLALLISRNNKMLTSQSAISAPVSA
A0A3Q3S6A5_MCL1-02      TVRHTLMAVAGVAGLGATLALLISYCGVM-------------
A0A3Q3MEY1_BCL2-03      IVRRCMIQREQSKSADKRE-----------------------
A0A3Q3MEY1_BCL2-04      IVRRCMIQREQSKSADKRE-----------------------
A0A3Q3MEY1_BCL2-05      IVRRCMIQREQSKSADKRE-----------------------
A0A3Q3MEY1_BCL2-09      IVRRCMIQREQSKSADKRE-----------------------
A0A3Q3MEY1_BCL2-06      IVRRCMIQREQSKSADKRE-----------------------
A0A3Q3MEY1_BCL2-08      IVRRCMIQREHDTALP--------------------------
A0A3Q3MEY1_BCL2-02      TIGAYLTQK---------------------------------
A0A3Q3MEY1_BCL2-07      IVRRCMIQREHDTALP--------------------------
A0A3Q3MEY1_BCL2-01      ITIGAYLTQK--------------------------------
A0A3Q3MX20_BCL2L1-      VVVGSLIAQKRL------------------------------
A0A3Q3NFM4_BCL2L1-      VLIGVLIAKKQ-------------------------------
                                                                  

© 1998-2022Legal notice