Dataset for protein BCL-2-like of organism Mastacembelus armatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3MEY1_BCL2-01      ---------------------------MANECNRNIVEKYICHKLSKRGY
A0A3Q3MX20_BCL2L1-      -----------------------------MSQNRELVVFYIKYKLSQRNY
A0A3Q3NFM4_BCL2L1-      ----------------------------MSYSNRELVEFFISYKLSQKNY
A0A7N8WMH7_BCL2L10      -----------------------MSCGLWKETLALAEDYLSLCCTSPQSV
A0A3Q3MEY1_BCL2-10      MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A3Q3S6A5_MCL1-01      -----------------------MSFIPSTRRAALIPGVMIVLPQDGVLE
A0A3Q3S6A5_MCL1-02      -----------------------MSFIPSTRRAALIPGVMIVLPQDGVLE
A0A3Q3MEY1_BCL2-03      MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-06      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-04      MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-05      MSSEESLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-09      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-02      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
A0A3Q3MEY1_BCL2-08      ----------------------------THLLDLWVYDLLTLL-------
A0A3Q3MEY1_BCL2-07      ---------------------------MLLVVAAFIVAFVLLLYMISPLI
                                                                          

A0A3Q3MEY1_BCL2-01      VWGFHNVQDEDAANN-------GSVVAPPPTV-----VRRCRDASTGPDS
A0A3Q3MX20_BCL2L1-      PLIYIELNEQQNRTD-------GGEAESGEEQRIATHANGTFNGTSPGTP
A0A3Q3NFM4_BCL2L1-      PTSLLRPEDAGGRTE-------GDMTGAAATNGLL--VNSRYVSGRPGMS
A0A7N8WMH7_BCL2L10      PPPP------------------SESAAAMRCLAQKMERQ-----------
A0A3Q3MEY1_BCL2-10      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQGAFITLVARDE
A0A3Q3S6A5_MCL1-01      GPVHYDSRDPSTQFTLDSRNGNGGTANPKRPKNLEVSSTNGYATKSIVAD
A0A3Q3S6A5_MCL1-02      GPVHYDSRDPSTQFTLDSRNGNGGTANPKRPKNLEVSSTNGYATKSIVAD
A0A3Q3MEY1_BCL2-03      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQGAFITLVARDE
A0A3Q3MEY1_BCL2-06      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQGAFITLVARDE
A0A3Q3MEY1_BCL2-04      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQGAFITLVARDE
A0A3Q3MEY1_BCL2-05      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQGAFITLVARDE
A0A3Q3MEY1_BCL2-09      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQGAFITLVARDE
A0A3Q3MEY1_BCL2-02      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQGAFITLVARDE
A0A3Q3MEY1_BCL2-08      ----------NFQVT-------GGSSGIGKCIAIECYRQGAFITLVARDE
A0A3Q3MEY1_BCL2-07      SPKPLKLNGAHVVVT-------GGSSGIGKCIAIECYRQGAFITLVARDE
                                              .                           

A0A3Q3MEY1_BCL2-01      ESIPQLC------------------RGLPQSDPQAAIHRVLREAGDELER
A0A3Q3MX20_BCL2L1-      PASPLRQ------------------EHLQSTASLDAVKEALRDSANEFEL
A0A3Q3NFM4_BCL2L1-      SS---------------------------PHGGVEAVKAALRDSAEEFEL
A0A7N8WMH7_BCL2L10      ---------HQARFHSLTQTFLKQCGPDPCSSLRKVIEELVADGHLNW--
A0A3Q3MEY1_BCL2-10      PGCLYSQ---------------------------------VKNAQEKL--
A0A3Q3S6A5_MCL1-01      TDDIEDG-----------SLPCTPELQSDSEAPSCPAGDEVLENDTRQ--
A0A3Q3S6A5_MCL1-02      TDDIEDG-----------SLPCTPELQSDSEAPSCPAGDEVLENDTRQ--
A0A3Q3MEY1_BCL2-03      TKLLQAK--KEVEKFAINDKQVVLCISVDVSSDYNQVESVIKQAQEKL--
A0A3Q3MEY1_BCL2-06      TKLLQAK--KEVEKFAINDKQVVLCISVDVSSDYNQVESVIKQAQEKL--
A0A3Q3MEY1_BCL2-04      PMPFNLRFHKTVYNFLIQVV---LCISVDVSSDYNQVESVIKQAQEKL--
A0A3Q3MEY1_BCL2-05      TKLLQAK--KEVEKFAINDK---QVWVYLSRSDF----FAVVQAQEKL--
A0A3Q3MEY1_BCL2-09      TKLLQAK--KEVEKFAINDKQVVLCISVDVSSDYNQVESVIKQAQEKL--
A0A3Q3MEY1_BCL2-02      TKLLQAK--KEVEKFAINDKQVVLCISVDVSSDYNQVESVIKQAQEKL--
A0A3Q3MEY1_BCL2-08      TKLLQAK--KEVEKFAINDKQVVLCISVDVSSDYNQVESVIKQAQEKL--
A0A3Q3MEY1_BCL2-07      TKLLQAK--KEVEKFAINDKQVVLCISVDVSSDYNQVESVIKQAQEKL--
                                                                : :       

A0A3Q3MEY1_BCL2-01      LYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGT
A0A3Q3MX20_BCL2L1-      RYARAFSDLHNQLHITPATAYQSFESVMDEVFRDGVNWGRIIGLFAFGGA
A0A3Q3NFM4_BCL2L1-      LFTQAFSDLSSQLDITPDTAYHSFKSVMDEVFKDGVNWGRIVGLFAFGGV
A0A7N8WMH7_BCL2L10      ------GRVVSLFTFTGVLSRQLMEQKGMKPGLDSGKGQELG--------
A0A3Q3MEY1_BCL2-10      ------GPVDMLVNCAGTSVSGKFEEVEVDRFK-----------------
A0A3Q3S6A5_MCL1-01      ------LICQYLKDVSGLSKPRWHDSKALSTMKRVVE-------------
A0A3Q3S6A5_MCL1-02      ------LICQYLKDVSGLSKPRWHDSKALSTMKRVVE-------------
A0A3Q3MEY1_BCL2-03      ------GPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAV
A0A3Q3MEY1_BCL2-06      ------GPVDMLVNCAGTSVSGKFEEVEVDRFK-----------------
A0A3Q3MEY1_BCL2-04      ------GPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAV
A0A3Q3MEY1_BCL2-05      ------GPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAV
A0A3Q3MEY1_BCL2-09      ------GPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAV
A0A3Q3MEY1_BCL2-02      ------GPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAV
A0A3Q3MEY1_BCL2-08      ------GPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAV
A0A3Q3MEY1_BCL2-07      ------GPVDMLVNCAGTSVSGKFEEVEVDRFKKLMEVNYLGSVYPTRAV
                                       :         .   .                    

A0A3Q3MEY1_BCL2-01      VCVECAAKEEMTSQVDNIAEWMTEYLNGPLNSWIQDNGGWDAFVEM----
A0A3Q3MX20_BCL2L1-      LCVECVEK-EMSPLVGRIVEWMTLYLDNHIEPWIQSQGGWEHFAEI----
A0A3Q3NFM4_BCL2L1-      LCVECIEK-NMSALVSRIADWMTMYLDEHISPWIESQGGWDCFAEI----
A0A7N8WMH7_BCL2L10      -------------------------------QGPESCRGLAETI------
A0A3Q3MEY1_BCL2-10      --------------------------------------------------
A0A3Q3S6A5_MCL1-01      ---------------------------DLLEKYRYTYNGMINKLSLDDRG
A0A3Q3S6A5_MCL1-02      ---------------------------DLLEKYRYTYNGMINKLSLDDRG
A0A3Q3MEY1_BCL2-03      ITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKP
A0A3Q3MEY1_BCL2-06      -----------------------------------------------IKP
A0A3Q3MEY1_BCL2-04      ITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKP
A0A3Q3MEY1_BCL2-05      ITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKP
A0A3Q3MEY1_BCL2-09      ITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKP
A0A3Q3MEY1_BCL2-02      ITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKP
A0A3Q3MEY1_BCL2-08      ITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKP
A0A3Q3MEY1_BCL2-07      ITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKP
                                                                          

A0A3Q3MEY1_BCL2-01      --------YDRQRESVFSCSWPSI--------------------------
A0A3Q3MX20_BCL2L1-      --------FGQDAAAESRRSQENF--------------------------
A0A3Q3NFM4_BCL2L1-      --------FGRDAAAEARRSQETL--------------------------
A0A7N8WMH7_BCL2L10      ------ADYLGEEKKDWLQENDGW-----------EGFCKFSHSAREVSH
A0A3Q3MEY1_BCL2-10      --------------------------------------------------
A0A3Q3S6A5_MCL1-01      DDVRFVSTVAKSLFADGTTNWGRI----ASLVAFGAVVCQ-------YLK
A0A3Q3S6A5_MCL1-02      DDVRFVSTVAKSLFADGTTNWGRI----ASLVAFGAVVCQ-------YLK
A0A3Q3MEY1_BCL2-03      YNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVR
A0A3Q3MEY1_BCL2-06      YNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVR
A0A3Q3MEY1_BCL2-04      YNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVR
A0A3Q3MEY1_BCL2-05      YNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVR
A0A3Q3MEY1_BCL2-09      YNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVR
A0A3Q3MEY1_BCL2-02      YNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVR
A0A3Q3MEY1_BCL2-08      YNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVR
A0A3Q3MEY1_BCL2-07      YNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVR
                                                                          

A0A3Q3MEY1_BCL2-01      --------------------------------------------------
A0A3Q3MX20_BCL2L1-      --------------------------------------------------
A0A3Q3NFM4_BCL2L1-      --------------------------------------------------
A0A7N8WMH7_BCL2L10      DSS-----------------------------------------------
A0A3Q3MEY1_BCL2-10      ---------------------------------------IITMGLF----
A0A3Q3S6A5_MCL1-01      EKGRGDCVELVGQEISTYLLSDQRDWLVKNNSWD----------------
A0A3Q3S6A5_MCL1-02      EKGRGDCVELVGQEISTYLLSDQRDWLVKNNSWD----------------
A0A3Q3MEY1_BCL2-03      DAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEALQQIITMGLF----
A0A3Q3MEY1_BCL2-06      DAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEALQQIITMGLF----
A0A3Q3MEY1_BCL2-04      DAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEALQQIITMGLF----
A0A3Q3MEY1_BCL2-05      DAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEALQQIITMGLF----
A0A3Q3MEY1_BCL2-09      DAI-------------------------------------ITMGLF----
A0A3Q3MEY1_BCL2-02      DAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEALQQDAFVEMYDRQR
A0A3Q3MEY1_BCL2-08      DAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEALQQIITMGLF----
A0A3Q3MEY1_BCL2-07      DAVQGNFNSSVGPD--GYMLSALTCGMSPVTSITEALQQIITMGLF----
                                                                          

A0A3Q3MEY1_BCL2-01      ------------KTVFGLAALGAASITIGAYLTQK---------------
A0A3Q3MX20_BCL2L1-      ------------KKWLLAGMTLVTGVVVGSLIAQKRL-------------
A0A3Q3NFM4_BCL2L1-      ------------RRWLLVGVALLTGVLIGVLIAKKQ--------------
A0A7N8WMH7_BCL2L10      ------------MKTALFAAAGVGLAGLTFLLVR----------------
A0A3Q3MEY1_BCL2-10      ------------RTIALFYLGSFDSIVRRCMIQREQSKSADKRE------
A0A3Q3S6A5_MCL1-01      ------------GFVEFFRVADPESTVRHTLMAVAGVAGLGATLALLISR
A0A3Q3S6A5_MCL1-02      ------------GFVEFFRVADPESTVRHTLMAVAGVAGLGATLALLISY
A0A3Q3MEY1_BCL2-03      ------------RTIALFYLGSFDSIVRRCMIQREQSKSADKRE------
A0A3Q3MEY1_BCL2-06      ------------RTIALFYLGSFDSIVRRCMIQREQSKSADKRE------
A0A3Q3MEY1_BCL2-04      ------------RTIALFYLGSFDSIVRRCMIQREQSKSADKRE------
A0A3Q3MEY1_BCL2-05      ------------RTIALFYLGSFDSIVRRCMIQREQSKSADKRE------
A0A3Q3MEY1_BCL2-09      ------------RTIALFYLGSFDSIVRRCMIQREQSKSADKRE------
A0A3Q3MEY1_BCL2-02      ESVFSCSWPSIKTVFGLAALGAASITIGAYLTQK----------------
A0A3Q3MEY1_BCL2-08      ------------RTIALFYLGSFDSIVRRCMIQREHDTALP---------
A0A3Q3MEY1_BCL2-07      ------------RTIALFYLGSFDSIVRRCMIQREHDTALP---------
                                                                          

A0A3Q3MEY1_BCL2-01      -----------------
A0A3Q3MX20_BCL2L1-      -----------------
A0A3Q3NFM4_BCL2L1-      -----------------
A0A7N8WMH7_BCL2L10      -----------------
A0A3Q3MEY1_BCL2-10      -----------------
A0A3Q3S6A5_MCL1-01      NNKMLTSQSAISAPVSA
A0A3Q3S6A5_MCL1-02      CGVM-------------
A0A3Q3MEY1_BCL2-03      -----------------
A0A3Q3MEY1_BCL2-06      -----------------
A0A3Q3MEY1_BCL2-04      -----------------
A0A3Q3MEY1_BCL2-05      -----------------
A0A3Q3MEY1_BCL2-09      -----------------
A0A3Q3MEY1_BCL2-02      -----------------
A0A3Q3MEY1_BCL2-08      -----------------
A0A3Q3MEY1_BCL2-07      -----------------
                                         

© 1998-2022Legal notice