Dataset for protein Bcl-w of organism Marmota marmota marmota

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6EU42_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A8C6EU42_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                        **************************************************

A0A8C6EU42_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A8C6EU42_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                        **************************************************

A0A8C6EU42_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTAL
A0A8C6EU42_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTAL
                        **************************************************

A0A8C6EU42_BCL2L2-      YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
A0A8C6EU42_BCL2L2-      YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
                        *******************************************

© 1998-2022Legal notice