Dataset for protein Bcl-w of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6AI25_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGE-GPAADPLHQAMRAA
A0A2K6AI25_BCL2L2-      --MEEEAEKLKELQNEV------EKQMNMSPPPGNAGPVIMSIEEKMEAD
A0A2K6AI25_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGE-GPAADPLHQAMRAA
                             .* . . *  :.      :*    .. **: **.  .: : * * 

A0A2K6AI25_BCL2L2-      GDEF---ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRL
A0A2K6AI25_BCL2L2-      ARSIYVGNVDYGATAEELEAHFH---GCGSVNRVTILCDKFSGHP---KG
A0A2K6AI25_BCL2L2-      GDEF---ETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRL
                        . .:   :. :  * .:* *::*   *... . . :  : *.* *   . 

A0A2K6AI25_BCL2L2-      VAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWEL
A0A2K6AI25_BCL2L2-      FAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPG-----------
A0A2K6AI25_BCL2L2-      VAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-
                        .*:: *.   .. :     *.*.   * .::.   .* .           

A0A2K6AI25_BCL2L2-      EAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEA
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K6AI25_BCL2L2-      DARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIE
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K6AI25_BCL2L2-      FSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRAR
A0A2K6AI25_BCL2L2-      ----------------------------------ISTTDRGFPRARYRAR
A0A2K6AI25_BCL2L2-      --------------------------------EFTALYGDGALEEARRLR
                                                           :  . *      * *

A0A2K6AI25_BCL2L2-      TTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K6AI25_BCL2L2-      TTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K6AI25_BCL2L2-      EGNWASVRTVLTGAV-------ALGALVTVGAFFASK
                          *: * *: : ...       .  . . . ::::. 

© 1998-2021Legal notice