Dataset for protein BCL-2-like of organism Loxodonta africana

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3T756_MCL1-01        -------------------MFGFKRNAVIGLNLYCGGAGLGAGGCATPPG
G3TMU7_BCL2L2-01      YIHVSLSSLTLAAARMATPASAPDTRALVADFVGY---------------
G3T8E6_BCL2A1-01      ---------------MTDCEFGYIYK-LVQDYLKY---------------
G3SPN0_BCL2L1-01      --------------------MSQSNRELVVDFLSY---------------
G3SLZ1_BCL2-01        --------------MAHAGRTGYDNREIVMKYIHY---------------
G3SLZ1_BCL2-02        --------------MAHAGRTGYDNREIVMKYIHY---------------
                                           .   . ::   :                 

G3T756_MCL1-01        GRLPAPGKEATARQEVGGGDAGASPPAAVAPDGRRVVRPAPIGAEGPDVT
G3TMU7_BCL2L2-01      -KLRQKGYVC-----------------------------------GAGPG
G3T8E6_BCL2A1-01      -VLQ-----------------------------------------IPQPA
G3SPN0_BCL2L1-01      -KLSQKGYSWSQFSDVEENRTGASEGTESEMEIPSAINGNPSRHLADSPA
G3SLZ1_BCL2-01        -KLSQRGYEW--------EAGEASAAPPGAAPAPGVLSSPPAAPRGPDTR
G3SLZ1_BCL2-02        -KLSQRGYEW--------EAGEA------------------------DTR
                        *                                               

G3T756_MCL1-01        AIPARPTFFAPTRRASPPVEMEALAADAIMSPEEELDGYEPEPLGKRPAV
G3TMU7_BCL2L2-01      EGPAA--------------DP-----------------------------
G3T8E6_BCL2A1-01      AGSSKTSRVLQNVAFSVQ-KE-----------------------------
G3SPN0_BCL2L1-01      VNGATGHSSSLDAREVIPMAA-----------------------------
G3SLZ1_BCL2-01        TSPLQADPAAQPALSPVP-PV-----------------------------
G3SLZ1_BCL2-02        TSPLQADPAAQPALSPVP-PV-----------------------------
                                                                        

G3T756_MCL1-01        FPRLGLVGEASNGPGTDGSLPSTPPLAEEEEDELYRQSLEIISRYLQEQA
G3TMU7_BCL2L2-01      --------------------------------------------------
G3T8E6_BCL2A1-01      --------------------------------------------------
G3SPN0_BCL2L1-01      --------------------------------------------------
G3SLZ1_BCL2-01        --------------------------------------------------
G3SLZ1_BCL2-02        --------------------------------------------------
                                                                        

G3T756_MCL1-01        TGAKDTKPMGGSGAASRKALETLRRVADGVQRNHETAFQGMLRKLDIKNE
G3TMU7_BCL2L2-01      ------------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPG
G3T8E6_BCL2A1-01      ------------------VEKNLKPCLDNF--------------VVISID
G3SPN0_BCL2L1-01      ------------------VKQALREAGDEFELRYRRAFSDLTSQLHITPG
G3SLZ1_BCL2-01        ------------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF
G3SLZ1_BCL2-02        ------------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF
                                            :.   * .              : :.  

G3T756_MCL1-01        DDVKSLSRVMAHVFSDGITNWGRIVTLISFGAFVAKHLKSVNQESRIE--
G3TMU7_BCL2L2-01      SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAESVNKEMEPLVG--
G3T8E6_BCL2A1-01      TAQTIFKQVMEKEFEDGIINWGRIVTIFAFGGILIKKLLRERIAPDVDTY
G3SPN0_BCL2L1-01      TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQVLVS--
G3SLZ1_BCL2-01        TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSPLVD--
G3SLZ1_BCL2-02        TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSPLVD--
                           :  *    * .*  ****:*::: **. :            :   

G3T756_MCL1-01        -PLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVED-------LEGGIRN
G3TMU7_BCL2L2-01      -QVQEWMVVYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWAS
G3T8E6_BCL2A1-01      KKISSFVAEFIVDNTAEWIRQNGGW--------ENG--FVKKFEPRSGWL
G3SPN0_BCL2L1-01      -RIATWMATYLNDHLEPWIQENGGWVRTTPLLCFST--SVKEDIAYVFIQ
G3SLZ1_BCL2-01        -NIALWMTEYLNRHLHTWIQDNGGWDAFVEL--YGP--NMRPLFDFSWLS
G3SLZ1_BCL2-02        -NIALWMTEYLNRHLHTWIQDNGGW-------------------------
                        :   :.  :      *: .. **                         

G3T756_MCL1-01        VLLAFAGVAGVGAGLA----YLIR
G3TMU7_BCL2L2-01      VRTVLTGAVALGALVTVGAFFASK
G3T8E6_BCL2A1-01      TFLEVTGKI-CEMLFLLKQYY---
G3SPN0_BCL2L1-01      VKTYASGKL-VQCFLTLTQWFTTQ
G3SLZ1_BCL2-01        LKTLLSLAL-VGACITLGAYLGHK
G3SLZ1_BCL2-02        ----------VGACVVE-------
                                    .         

© 1998-2020Legal notice