Dataset for protein BCL-2-like of organism Loxodonta africana

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3T756_MCL1-01        MFGFKRNAVIGLNLYCGGAGLGAGGCATPPGGRLPAPGKEATARQEVGGG
G3TMU7_BCL2L2-01      --------------------------------------------------
G3T8E6_BCL2A1-01      --------------------------------------------------
G3TVG9_MCL1-01        --------------------------------------------------
G3SPN0_BCL2L1-01      --------------------------------------------------
G3SLZ1_BCL2-01        --------------------------------------------------
G3SLZ1_BCL2-02        --------------------------------------------------
                                                                        

G3T756_MCL1-01        DAGASPPAAVAPDGRRVVRPAPIGAEGPDVTAIPARPTFFAPTRRASPPV
G3TMU7_BCL2L2-01      ----------YIHVSLSSLTLAAARMATPASAPDTRALVADFV-------
G3T8E6_BCL2A1-01      ----------------------------------MTDCEFGYI-------
G3TVG9_MCL1-01        -----------------------GAQGPSVTATPARPMLFASIPCTSPPE
G3SPN0_BCL2L1-01      ------------------------------MSQSNRELVVDFL-------
G3SLZ1_BCL2-01        ------------------------MAHAGRTGYDNREIVMKYI-------
G3SLZ1_BCL2-02        ------------------------MAHAGRTGYDNREIVMKYI-------
                                                                        

G3T756_MCL1-01        EMEALAADAIMSPEEELDGYEPEPLG--------------------KRPA
G3TMU7_BCL2L2-01      ------------------GYKLRQKGYVC---------------------
G3T8E6_BCL2A1-01      -------------------YKLVQDYLKY---------------------
G3TVG9_MCL1-01        EANASVAEAIMSAEEELGRYKLETLG--------------------KRPA
G3SPN0_BCL2L1-01      ------------------SYKLSQKGYSWSQFSDVEENRTGASEGTESEM
G3SLZ1_BCL2-01        ------------------HYKLSQRGYEW--------EAGEASAAPPGAA
G3SLZ1_BCL2-02        ------------------HYKLSQRGYEW--------EAGEA--------
                                         *:                             

G3T756_MCL1-01        VFPRLGLVGEASNGPGTDGSLPSTPPLAEEEEDELYR-QSLEIISRYLQE
G3TMU7_BCL2L2-01      ---------------------------GAGPGEGPAA-DPLHQAMR----
G3T8E6_BCL2A1-01      ---VLQIPQPAAGSSKTSRVLQNVAFSVQKEVEKNLK-PCLDNFVV----
G3TVG9_MCL1-01        ALPLLVLVGEASNCPGTHGALPSTQPPAEEEEDKLYP-QSLDIIFRYLHE
G3SPN0_BCL2L1-01      EIPSAINGNPSRHLADSPAVNGATGHSSSLDAREVIPMAAVKQALR----
G3SLZ1_BCL2-01        PAPGVLSSPPAAPRGPDTRTSPLQADPAAQPALSPVP-PVVHLTLR----
G3SLZ1_BCL2-02        ----------------DTRTSPLQADPAAQPALSPVP-PVVHLTLR----
                                                              :         

G3T756_MCL1-01        QATGAKDTKPMGGSGAASRKALETLRRVADGVQRNHETAFQGMLRKLDIK
G3TMU7_BCL2L2-01      --------------------------AAGDEFETRFRRTFSDLAAQLHVT
G3T8E6_BCL2A1-01      ------------------------------------------------IS
G3TVG9_MCL1-01        QAIGATQGRQLEG--------VRNLPRVADGVQRNEETVSQGMLRKPDFK
G3SPN0_BCL2L1-01      --------------------------EAGDEFELRYRRAFSDLTSQLHIT
G3SLZ1_BCL2-01        --------------------------QAGDDFSRRYRRDFAEMSSQLHLT
G3SLZ1_BCL2-02        --------------------------QAGDDFSRRYRRDFAEMSSQLHLT
                                                                      ..

G3T756_MCL1-01        NEDDVKSLSRVMAHVFSDGITNWGRIVTLISFGAFVAKHLKSVNQESRIE
G3TMU7_BCL2L2-01      PGSAQQRFTQVSDELFQGGP-NWGRLVAFFVFGAALC--AESVNKEMEPL
G3T8E6_BCL2A1-01      IDTAQTIFKQVMEKEFEDGIINWGRIVTIFAFGGILI--KKLLRERIAPD
G3TVG9_MCL1-01        NENDVKSLSGAMVHVFSGGITKWGRIVT-ISFGAFVVKHFGSINQEAAAE
G3SPN0_BCL2L1-01      PGTAYQSFEQVVNELFRDGV-NWGRIVAFFSFGGALC--VESVDKEMQVL
G3SLZ1_BCL2-01        PFTARGRFATVVEELFRDGV-NWGRIVAFFEFGGVMC--VESVNREMSPL
G3SLZ1_BCL2-02        PFTARGRFATVVEELFRDGV-NWGRIVAFFEFGGVMC--VESVNREMSPL
                             :  .    * .*  :***:*: : **. :      :       

G3T756_MCL1-01        -----PLAESITDVLVRTKR--------DWLVKQRGWDGFVEFFHVEDLE
G3TMU7_BCL2L2-01      VG---QVQEWMVVYLETRLA--------DWIHSSGGWAEFTALYGDGALE
G3T8E6_BCL2A1-01      VDTYKKISSFVAEFIVDNTA--------EWIRQNGGW--------ENG--
G3TVG9_MCL1-01        CI---TDVLLRKRYCLDKRRGGDGLVEFVHVKDPQGDCRNVQLAFAG---
G3SPN0_BCL2L1-01      VS---RIATWMATYLNDHLE--------PWIQENGGWVRTTPLLCFST--
G3SLZ1_BCL2-01        VD---NIALWMTEYLNRHLH--------TWIQDNGGWDAFVEL--YGP--
G3SLZ1_BCL2-02        VD---NIALWMTEYLNRHLH--------TWIQDNGGW-------------
                                                   .: .  *              

G3T756_MCL1-01        GGIRNVLLAFAGVAGVGAGLA-----------YLIR
G3TMU7_BCL2L2-01      EARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
G3T8E6_BCL2A1-01      FVKKFEPRSGWLTFLEVTGKI-CEMLFLLKQYY---
G3TVG9_MCL1-01        ------------------------------------
G3SPN0_BCL2L1-01      SVKEDIAYVFIQVKTYASGKL-VQCFLTLTQWFTTQ
G3SLZ1_BCL2-01        NMRPLFDFSWLSLKTLLSLAL-VGACITLGAYLGHK
G3SLZ1_BCL2-02        ----------------------VGACVVE-------
                                                          

© 1998-2020Legal notice