Dataset for protein BCL-2-like of organism Ictalurus punctatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2D0RCW7_MCL1-02      ---------------------------------METAQLVNPLKTALSRA
A0A2D0RCW7_MCL1-03      MCAQLNAENGNLSMMFSPKDLSLTVPNVSSGYKEKPLAVVAPFQRPILNL
A0A2D0RCW7_MCL1-01      ---------------LGPKDLSLTVPNVSSGYKEKPLAVVAPFQRPILNL
W5U9J4_BCL2L1-01        -------------MSYYNRELVVYFIKYKLSQRNYPCNHIGLTEDVNGTE
                                                           .   :   :      

A0A2D0RCW7_MCL1-02      G-------------------------------------------------
A0A2D0RCW7_MCL1-03      GISSENQRGLSDGSLPTSPEVDCDEVLGVGCFLEHNTREIIADFLLLFTS
A0A2D0RCW7_MCL1-01      GISSENQRGLSDGSLPTSPEVDCDEVLGVGCFLEHNTREIIADFLLLFTS
W5U9J4_BCL2L1-01        GGQAEEASAEGAAELETPTAVVNGAVNGTGS---------------AGTP
                        *                                                 

A0A2D0RCW7_MCL1-02      ------------------NTLKCARQGVLPGTGF---GMLAKLCLDERGD
A0A2D0RCW7_MCL1-03      PSRP-LGRHRKV-----LQTMKCVVDGLLVKHELVYKGMLAKLCLDERGD
A0A2D0RCW7_MCL1-01      PSRP-LGRHRKV-----LQTMKCVVDGLLVKHELVYKGMLAKLCLDERGD
W5U9J4_BCL2L1-01        PQSPTLSPRRQVNGGASLEAVKEALRDSANEFELRYARAFSDLSSQLHIT
                                          :::* .  .      :     ::.*. : .  

A0A2D0RCW7_MCL1-02      DMSV---ISSVATELFSDGVTNWGRIASLLAFGAVVSKYEMESGRGHCPS
A0A2D0RCW7_MCL1-03      DMSV---ISSVATELFSDGVTNWGRIASLLAFGAVVSKYEMESGRGHCPS
A0A2D0RCW7_MCL1-01      DMSV---ISSVATELFSDGVTNWGRIASLLAFGAVVSKYEMESGRGHCPS
W5U9J4_BCL2L1-01        PVTVYQSFESVMDEVFRDGV-NWGRIVGLFAFGGALCVECVEKEMSPLVA
                         ::*   :.**  *:* *** *****..*:***..:.   :*.  .   :

A0A2D0RCW7_MCL1-02      IVAEEISSYLLFNQKEWLLKNNSWDGFVEFFHVPDPESSVRSALT-----
A0A2D0RCW7_MCL1-03      IVAEEISSYLLFNQKEWLLKNNSWDGFVEFFHVPDPESSVRSALT-----
A0A2D0RCW7_MCL1-01      IVAEEISSYLLFNQKEWLLKNNSWDGFVEFFHVPDPESSVRSALT-----
W5U9J4_BCL2L1-01        RIAEWMTVYLDNHIQPWIQEQGGWERFAEIFGKDAAAESRRSQESFKKWL
                         :** :: **  : : *: ::..*: *.*:*    . .* **  :     

A0A2D0RCW7_MCL1-02      ----TIVTVAGIGAVLAYLTR
A0A2D0RCW7_MCL1-03      ----TIVTVAGIGAVLAYLTR
A0A2D0RCW7_MCL1-01      ----TIVTVAGIGAVLAYLTR
W5U9J4_BCL2L1-01        LAGMTLFTGVVLGSFIAQKRL
                            *:.* . :*:.:*    

© 1998-2020Legal notice